Align gluconolactonase subunit (EC 3.1.1.17) (characterized)
to candidate SMa0196 SMa0196 gluconolactonase
Query= metacyc::MONOMER-13276 (356 letters) >FitnessBrowser__Smeli:SMa0196 Length = 304 Score = 150 bits (380), Expect = 3e-41 Identities = 100/314 (31%), Positives = 161/314 (51%), Gaps = 35/314 (11%) Query: 53 PRLDAILDVSTPIEVIASDIQWSEGPVWVKNGNFLLFSDPPANIMRKWTPDAGVSIFLKP 112 PR ++ S ++ + S +W+EGPVW + N LL+SD P + +WTP+ GVS++ +P Sbjct: 12 PRFRQMIVTSAGLDELYSGCRWAEGPVWFNDANQLLWSDIPNQRILRWTPEGGVSVYRQP 71 Query: 113 SGHAEPIPAGQFREPGSNGMKVGPDGKIWVADSGTRAIMKVDPVTRQRSVVVDNYKGKRF 172 S +NG G++ + GTR + + + V +V+ D ++G+R Sbjct: 72 SNF-------------TNGHTRDRRGRLISCEHGTRRVTRTE-VDGSITVLADRFEGRRL 117 Query: 173 NSPNDLFFSKSGAVYFTDPPYGLTNLDE---SDIKEMNYNGVFRLSPD-GRLDLIEAGLS 228 NSPND+ G ++FTDP YG+ + E +D ++ N V+RL P+ G L + + Sbjct: 118 NSPNDVVVKSDGTIWFTDPTYGIMSDYEGYHADPEQPTRN-VYRLDPETGELSAVVTDFT 176 Query: 229 RPNGLALSPDETKLYVSNS-----DRASPNIWVYSLDSNGLPTSRTLLRNFRKEYFDQGL 283 +PNGLA SPDE LYV++S DR +I + L G + + K Sbjct: 177 QPNGLAFSPDEKILYVADSSASHDDRLPRHIRAFDLTDGGRLANGRVFCVIDK------- 229 Query: 284 AGLPDGMNIDKQGNLFASAPGGIYIFAPDGECLGLISGNPGQPLSNCCF-GEKGQTLFIS 342 G+PDG+ D GNL++SA G++ F G+ +G I Q ++N F G + LFI+ Sbjct: 230 -GIPDGIRTDANGNLWSSAGDGVHCFDTAGKLIGKI--RVPQTVANLTFGGPRRNRLFIA 286 Query: 343 ASHNVVRVRTKTFG 356 A+ ++ V G Sbjct: 287 ATRSLYSVYVAVTG 300 Lambda K H 0.317 0.135 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 365 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 304 Length adjustment: 28 Effective length of query: 328 Effective length of database: 276 Effective search space: 90528 Effective search space used: 90528 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory