Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate SMc01943 SMc01943 2-hydroxyacid dehydrogenase
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >FitnessBrowser__Smeli:SMc01943 Length = 325 Score = 207 bits (527), Expect = 3e-58 Identities = 132/307 (42%), Positives = 167/307 (54%), Gaps = 9/307 (2%) Query: 7 WKSLPEDVLAYLQQHAQVVQVDATQHDAFVAALKDADGGIGSSVKITPA--MLEGATRLK 64 W E VLA + A AL++ D + + PA G R + Sbjct: 14 WPQAVERVLAERFDTVLNEEDRPLDRSALADALRNFDAVLPTVSDRLPADVFTGGGLRTR 73 Query: 65 ALSTISVGFDQFDVADLTRRGIVLANTPDVLTESTADTVFSLILASARRVVELAEWVKAG 124 L VG++ D GIV+ NTP VLT+ TAD SL+LA+ARR E V+AG Sbjct: 74 ILGNFGVGYNHIDAGAAKEAGIVVTNTPGVLTDCTADLAVSLLLAAARRTGEGERQVRAG 133 Query: 125 HWQHSIGPALFGVDVQGKTLGIVGLGRIGGAVARRAALGFNMKVLYTNRS-ANPQAEEAY 183 W + G V GKTLGI+G GRIG A+A+R GF+M +++ NRS P+ + Sbjct: 134 AWDGWRPTHMIGTKVTGKTLGIIGFGRIGKAMAKRCHFGFDMDIVFYNRSRVAPEEAARF 193 Query: 184 GARRVELAE-LLATADFVCLQVPLTPETKHLIGAAELKSMKKSAILINASRGATVDEKAL 242 GAR+++ E +L ADFV L P E +HLI AA L +MK +A LIN SRG VDE AL Sbjct: 194 GARQLDTVEDVLRAADFVSLHCPGGGENRHLINAARLAAMKPAAYLINTSRGDVVDEAAL 253 Query: 243 IEALQNGTIHGAGLDVFETEPLPSDSP--LLKLANVVALPHIGSATHETRHAMARNAAEN 300 I AL+ G I GAGLDV+E EP D P L L NVV LPH+GSAT ETR AM +N Sbjct: 254 IAALEKGVIRGAGLDVYEAEP---DVPTRLRALENVVLLPHLGSATEETRTAMGMKVVDN 310 Query: 301 LVAALDG 307 + A G Sbjct: 311 ITAFFAG 317 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 217 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 325 Length adjustment: 28 Effective length of query: 293 Effective length of database: 297 Effective search space: 87021 Effective search space used: 87021 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory