Align galactose-6-phosphate isomerase lacB subunit (EC 5.3.1.26) (characterized)
to candidate SMc01613 SMc01613 ribose-5-phosphate isomerase B
Query= metacyc::MONOMER-2782 (171 letters) >FitnessBrowser__Smeli:SMc01613 Length = 145 Score = 78.6 bits (192), Expect = 4e-20 Identities = 45/146 (30%), Positives = 76/146 (52%), Gaps = 5/146 (3%) Query: 1 MKIALGCDHIVTDTKMRVSEFLKSKGHEVIDVGTYDFTRT-HYPIFGKKVGEQVVSGNAD 59 MKIA+G D ++ L + D+ D ++T +Y + + + + +G + Sbjct: 1 MKIAIGADSAGKPLLDVIAAHLAKRS----DLEVKDLSQTGYYADLSRDLAQTITAGENE 56 Query: 60 LGVCICGTGVGINNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGRIIGELLMCDI 119 G+ ICGTG+G+ + NKVPG+R+AL D SA A + NA +I G R+IG L I Sbjct: 57 RGILICGTGIGVCISANKVPGIRAALTHDTYSAERAAKSNNAQIITMGARVIGPELAKSI 116 Query: 120 IDAFINAEYKPTEENKKLIAKIKHLE 145 +D ++ +E+ P + + I L+ Sbjct: 117 VDTWLASEFDPNGPSAANVEAIDRLD 142 Lambda K H 0.320 0.139 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 71 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 171 Length of database: 145 Length adjustment: 17 Effective length of query: 154 Effective length of database: 128 Effective search space: 19712 Effective search space used: 19712 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory