Align LacF, component of Lactose porter (characterized)
to candidate SM_b20232 SM_b20232 sugar ABC transporter permease
Query= TCDB::P29823 (298 letters) >FitnessBrowser__Smeli:SM_b20232 Length = 314 Score = 165 bits (418), Expect = 1e-45 Identities = 103/299 (34%), Positives = 166/299 (55%), Gaps = 11/299 (3%) Query: 2 ATTSRSSLKRYYDVNGWLFVAPAIALISVFMLYPILRSLVLSLYTGRGMM-LKFSGTGNL 60 A +R S K + G+LFV P + +F+ P+ SLVLS++ G F G N Sbjct: 14 AGRTRLSAKHREWIAGYLFVLPDALGLFIFLGVPMALSLVLSVFEVNGFGGYSFVGARNY 73 Query: 61 VRLWNDPVFWQALQNTVIFFVVQVPIMITMALILAAMLNNPKLRYSGLFRTMIFLPCVSS 120 +R+WNDP+FW+ + T ++ + VP++ L LA ++ R++ + R+M F P + S Sbjct: 74 LRMWNDPLFWKGARVTALYAAMLVPLLYVCGLGLALLVQRTD-RFNAIMRSMFFAPHMVS 132 Query: 121 LVAYSILFKSMF-SLDGVVNNTLLAIGIIGEPIGWLTDPFWAKVLIIIAITWRWTGYNMI 179 LV +++++ M GVV+ A+ I G I L DP +A + I++ W G+ M+ Sbjct: 133 LVVVALVWQFMVVDKIGVVSRLTAALDIGG--ISLLGDPNFALITIVLVSVWFLMGFYML 190 Query: 180 FYLAALQNIDRSIYEAAKIDGVPSWGRFAFLTIPMLKPVILFTTITSTIGTL---QLFDE 236 +L LQ+I R YEAA IDG + RF F+T+P+LKP F + S + + Q FD Sbjct: 191 IFLGGLQDIPRQYYEAAMIDGAGAIARFWFITLPLLKPTSFFVIMVSMVAAVAGAQAFDI 250 Query: 237 VYNFTEGTGGPANSTLTLSLYIYNLTFRFMPSFSYAATVSYVIVLMVAVLSFLQFYAAR 295 +Y T+ GGPAN+T L +YIY F F +F YAA ++ ++V+ + +++ + F R Sbjct: 251 IYVMTK--GGPANATSVLIVYIYQQAFGF-GAFGYAAAMASILVVALMIVTAVFFALTR 306 Lambda K H 0.329 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 252 Number of extensions: 17 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 314 Length adjustment: 27 Effective length of query: 271 Effective length of database: 287 Effective search space: 77777 Effective search space used: 77777 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory