Align ABC transporter for Lactose, permease component 1 (characterized)
to candidate SM_b20633 SM_b20633 sugar uptake ABC transporter permease
Query= reanno::Smeli:SM_b21653 (298 letters) >FitnessBrowser__Smeli:SM_b20633 Length = 305 Score = 147 bits (372), Expect = 2e-40 Identities = 92/295 (31%), Positives = 151/295 (51%), Gaps = 6/295 (2%) Query: 5 RRGIGRYYDVNGWLFVAPALGLITLFMVYPIAWSLWMSFQSGRGM-TLKFAGFANIVRLW 63 RR R G +++APA+ L+TLF V P+ ++LWMS + + G N R++ Sbjct: 12 RRRPKRQAGWRGLIYIAPAMALVTLFFVLPVLFTLWMSLHKWPLLGEPAWIGLRNYTRMF 71 Query: 64 NDPVFIKALTNTMTYFVVQVPIMILLALILASLLNNPRLVGRGVFRTAIFLPCVSSLVAY 123 D F AL T Y ++ + +A LA + R + ++RT +FLP V L + Sbjct: 72 TDARFFNALGFTAHYTLIVTIAIFAVAFPLAIFVEKQRPLV-SLYRTIVFLPVVVGLASA 130 Query: 124 SVLFKGMFATD-GIVNSTLQAIGLAASPIPWLTHPFWAKVLVILAITWRWTGYNMIFYLA 182 S+L+ + D G+ +GL + I L A + +I+ + W+ G+ MI L Sbjct: 131 SLLWVWLANVDSGLFAPLFDMLGLTSGRINLLAKFDTAFLTIIVMVVWKIAGFTMIILLT 190 Query: 183 ALQNIDKSIYEVARIDGVPAWARLTHLTIPLLKPVILFTTVISTIGTLQLFDEVYNLTEG 242 LQ I + E ARIDG W R HLT+PL++ + ++S G++ FD+ Y +T Sbjct: 191 GLQAIPAELTEAARIDGAGRWQRFRHLTLPLMRRTMALALILSVTGSILAFDQFYIMT-- 248 Query: 243 KGGPSNATLTLSLYIYNLTFRFMPNLGYAATVSYVIVVLVALLAFVQFFAARERD 297 GGP N +++ YI+N +F NLGY A +S +++++ L+ VQ + + D Sbjct: 249 SGGPQNKMISVVYYIFNQSFVSF-NLGYGAALSIALLLILVTLSVVQLWLLKVGD 302 Lambda K H 0.330 0.142 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 244 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 305 Length adjustment: 27 Effective length of query: 271 Effective length of database: 278 Effective search space: 75338 Effective search space used: 75338 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory