Align LacF, component of Lactose porter (characterized)
to candidate SM_b20970 SM_b20970 sugar uptake ABC transporter permease
Query= TCDB::P29823 (298 letters) >FitnessBrowser__Smeli:SM_b20970 Length = 319 Score = 145 bits (365), Expect = 2e-39 Identities = 99/275 (36%), Positives = 150/275 (54%), Gaps = 10/275 (3%) Query: 18 WLFVAPAIALISVFMLYPILRSLVLSLYTGRGMMLK-FSGTGNLVRLW-NDPVFWQALQN 75 +LF++P I F L P+ SL +S + + + F G N ++ DP F ++L Sbjct: 28 FLFISPWILGFLFFTLGPLCFSLTMSFFDWPVVGERTFVGLDNYRSMFMEDPQFRESLWI 87 Query: 76 TVIFFVVQVPIMITMALILAAMLNNPKLRYSGLFRTMIFLPCVSSLVAYSILFKSMFSLD 135 TV F + VP I M+ +LA +L++ SG FRT+ +LP V S VA ++ ++S + Sbjct: 88 TVKFAAIYVPFNIVMSFLLALLLHHATFA-SGFFRTVFYLPSVISGVALVTIWSWIYSRE 146 Query: 136 -GVVNNTLLAIGIIGEPIGWLTDPFWAKVLIIIAITWRWTGYNMIFYLAALQNIDRSIYE 194 G++N L +GI G WL DP A V II+A W G M+ L L+ I + +YE Sbjct: 147 YGLLNFMLSLVGIDGP--NWLGDPSLALVAIIVASLWGLGG-TMLILLTGLKAIPKELYE 203 Query: 195 AAKIDGVPSWGRFAFLTIPMLKPVILFTTITSTIGTLQLFDEVYNFTEGTGGPANSTLTL 254 AA + GVP W + F+T+PML P+++FT ITS I Q T+ GGP ST Sbjct: 204 AATVSGVPGWAQMVFITLPMLGPMLIFTFITSIISAFQQLTIALLLTK--GGPLGSTYFF 261 Query: 255 SLYIYNLTFRFMPSFSYAATVSYVIVLMVAVLSFL 289 ++YIY+ F++ YAA S+V+ ++V LS + Sbjct: 262 AMYIYDNAFKYF-DMGYAAAGSWVMFVIVLTLSLV 295 Lambda K H 0.329 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 301 Number of extensions: 17 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 319 Length adjustment: 27 Effective length of query: 271 Effective length of database: 292 Effective search space: 79132 Effective search space used: 79132 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory