Align ABC transporter for Lactose, permease component 2 (characterized)
to candidate SM_b20418 SM_b20418 glycerol-3-phosphate ABC transporter permease
Query= reanno::Smeli:SM_b21654 (272 letters) >FitnessBrowser__Smeli:SM_b20418 Length = 282 Score = 132 bits (332), Expect = 8e-36 Identities = 83/261 (31%), Positives = 140/261 (53%), Gaps = 15/261 (5%) Query: 25 VFPFIWMVLGATNSSIDIIKGK--LLPGAAFATNVANFFT-----LVNVPL--VFWNSAK 75 VFP + + ++ SS++II+ L+PG A N + + +V V L + +N+ Sbjct: 24 VFPIYYTFVASSMSSVEIIRPPMPLVPGTRLAENYSEALSGGVERVVGVSLERLLFNTFV 83 Query: 76 IAIVATVLTLAVSSLAGYGFEMFRSRRRERVYRAMLLTLMIPFAALMIPLFVMMGKAGLI 135 +AI V + +S L+ + FR R + + +TLM+P ++P + ++ GLI Sbjct: 84 VAIAIAVGKIVISFLSAFAIVFFRFPLRMAFFWMIFITLMLPVEVRILPTYKVIVDLGLI 143 Query: 136 NTHLAVVLPSIGSAFVIFYFRQSTKAFPSELRDAAKVDGLKEWQIFLFIYVPVMRSTYAA 195 +T+ + LP + SA F FRQ P EL +AA++D ++ I +P+ ++ AA Sbjct: 144 DTYAGLTLPLMASATATFLFRQFFLTIPGELVEAARIDNAGPFRFMRDILLPLSKTNIAA 203 Query: 196 AFVIVFMTAWNNYLWPLIVLQTNETKTITLVISSLASAYYPD----YGVVMVGTILATLP 251 FVI+F+ W YLWPL+V TN+++ T++I + D + VMV ILA +P Sbjct: 204 LFVILFIYGWTQYLWPLLV--TNDSRMNTIIIGLRKMVDFTDASTPWNYVMVTAILAIIP 261 Query: 252 TLAVFFFMQRQFVQGMLGSVK 272 +AV MQR FV+G++ + K Sbjct: 262 PVAVVVLMQRWFVKGLVETEK 282 Lambda K H 0.331 0.141 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 282 Length adjustment: 25 Effective length of query: 247 Effective length of database: 257 Effective search space: 63479 Effective search space used: 63479 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory