Align Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial; Branched-chain alpha-keto acid dehydrogenase complex component E2; BCE2; BCKAD-E2; BCKADE2; Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto acid dehydrogenase complex; Dihydrolipoamide branched chain transacylase; Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase; Protein DARK INDUCIBLE 3; EC 2.3.1.168 (characterized)
to candidate SM_b20019 SM_b20019 dihydrolipoamide succinyltransferase
Query= SwissProt::Q9M7Z1 (483 letters) >FitnessBrowser__Smeli:SM_b20019 Length = 378 Score = 137 bits (345), Expect = 6e-37 Identities = 115/392 (29%), Positives = 185/392 (47%), Gaps = 42/392 (10%) Query: 74 GLIDV--PLAQTGEGIAECELLKWFVKEGDSVEEFQPLCEVQSDKATIEITSRFKGKVAL 131 G ID+ PL Q G + + W K GD V+ PL E+++DK T E+++ G +A Sbjct: 3 GFIDIQAPLEQEG---TKAVVRNWLRKIGDPVKSGDPLVELETDKVTQEVSAPADGVLAE 59 Query: 132 ISHSPGDIIKVGETLVRLAVEDSQDSLLTTDSSEIVTLGGSKQGTENLLGALSTPAVRNL 191 I GD G L R+ SE G + +PAVR+ Sbjct: 60 ILMRNGDDATPGAVLGRIG-------------SEAAGAGHAPH---------YSPAVRHA 97 Query: 192 AKDLGIDINVITGTGKDGRVLKEDVLRFSDQKGFVTDSVSSEHAVIGGDSVSTKASSNFE 251 A++ G+D +TGTG+ GRV + D+ R + SV++E GD + S Sbjct: 98 AEEYGLDPATVTGTGRGGRVTRADMDRAFTARQEGPASVAAE----AGDRGAAPKS---- 149 Query: 252 DKTVPLRGFSRAMVKTM-TMATSVPHFHFVEEINCDSLVELKQFFKENNTDSTIKHTFLP 310 + +P G A+ + M T+ PH V E + +++ + + K ++ Sbjct: 150 -RRIPHSGMRAAIAEHMLNSVTTAPHVTAVFEADFSAVMRHRDEHGKRLAADGTKLSYTA 208 Query: 311 TLIKSLSMALTKYPFVNSCFNAESLEIILKGSHNIGVAMATEHGLVVPNIKNVQSLSLLE 370 ++ + A+ P VNS ++ ++LE + +G+++ + GLVVP I Q LSL E Sbjct: 209 YVVSACVAAMRAVPEVNSRWHEDALETFDDINIGVGISLG-DKGLVVPVIHRAQDLSLAE 267 Query: 371 ITKELSRLQHLAANNKLNPEDVTGGTITLSNIGAIGGKFGSP-LLNLPEVAIIALGRIEK 429 I L L A +N L+ DVTGGT T+SN GA G +P ++N P+ AI+ +G+++K Sbjct: 268 IAARLQDLTTRARSNALSRADVTGGTFTISNHGASGSLLAAPIIINQPQSAILGVGKLDK 327 Query: 430 ---VPKFSKEGTVYPASIMMVNIAADHRVLDG 458 V + T+ + V++ DHR LDG Sbjct: 328 RVIVREVDGADTIQIRPMAYVSLTIDHRALDG 359 Lambda K H 0.317 0.132 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 376 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 483 Length of database: 378 Length adjustment: 32 Effective length of query: 451 Effective length of database: 346 Effective search space: 156046 Effective search space used: 156046 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory