Align methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate SMc01669 SMc01669 enoyl-CoA hydratase
Query= BRENDA::Q1D5Y4 (258 letters) >FitnessBrowser__Smeli:SMc01669 Length = 263 Score = 144 bits (362), Expect = 2e-39 Identities = 86/257 (33%), Positives = 137/257 (53%), Gaps = 4/257 (1%) Query: 6 VDARGPIEIWTIDGESRRNAISRAMLKELGELVTRVSSSRDVRAVVITGAGDKAFCAGAD 65 ++ I + T++ + NA++ ++ L L+ R+ V+AV++TGAGD+AF AG D Sbjct: 7 IEISAGIALLTLNRPEKLNALNYELIDRLLALLDRIEIDETVQAVILTGAGDRAFSAGGD 66 Query: 66 LKE-RATMAEDEVRAFLDGLRRTFRAIEKSDCV---FIAAINGAALGGGTELALACDLRV 121 + E ++A+ A D +RR + + + IAA+NG A GGG E+ A L + Sbjct: 67 IHEFSGSVAKGVNAATRDFVRRGQQLTHRLEAFPKPVIAAVNGLAYGGGCEVTEAVHLAI 126 Query: 122 AAPAAELGLTEVKLGIIPGGGGTQRLARLVGPGRAKDLILTARRINAAEAFSVGLANRLA 181 A+ A E+KL + P GGTQRL RL G RA +L+LT + A +GL N + Sbjct: 127 ASERARFAKPEIKLAMPPTFGGTQRLPRLAGRKRALELLLTGDAFSPQRALDMGLVNAVV 186 Query: 182 PEGHLLAVAYGLAESVVENAPIAVATAKHAIDEGTGLELDDALALELRKYEEILKTEDRL 241 P L+A A LA + ++P+A A A+ G + + + L E ++ ++ + D Sbjct: 187 PHEQLIASARALAGRTIRHSPLATAAIITAVTRGLNMAIGEGLLCESEQFARMVPSHDLK 246 Query: 242 EGLRAFAEKRAPVYKGR 258 EGL A+ E+R P Y GR Sbjct: 247 EGLAAWKERREPRYAGR 263 Lambda K H 0.319 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 140 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 263 Length adjustment: 25 Effective length of query: 233 Effective length of database: 238 Effective search space: 55454 Effective search space used: 55454 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory