GapMind for catabolism of small carbon sources

 

Aligments for a candidate for livH in Sinorhizobium meliloti 1021

Align ABC transporter permease (characterized, see rationale)
to candidate SM_b20604 SM_b20604 branched-chain amino acid ABC transporter permease

Query= uniprot:A0A165KC95
         (309 letters)



>lcl|FitnessBrowser__Smeli:SM_b20604 SM_b20604 branched-chain amino
           acid ABC transporter permease
          Length = 537

 Score =  142 bits (359), Expect = 1e-38
 Identities = 94/297 (31%), Positives = 156/297 (52%), Gaps = 14/297 (4%)

Query: 6   QQIINGLVLGSMYALIALGYTMVYGIIQLINFAHGEVLMIGALTSWSCIGMMQGAMPGAP 65
           Q I  GL LGS+  L A+G  + +G++ +IN AHGE++M+GA T++    +++ + P   
Sbjct: 243 QNIWYGLSLGSVLLLAAIGLAITFGVMGIINMAHGEMVMLGAYTTFLVQDVVRTSFPHLF 302

Query: 66  GWVILLLATIIACVVAATLNFVIEKVAYRPLRSSPRLAPLITAIGMSILLQTLAMIIWKP 125
            W  L +A  +A +V   +   +E+   R L   P L  L+   G+S++LQ     I+ P
Sbjct: 303 EWS-LAIALPLAFLVTGAVGLALERGVIRFLYGRP-LETLLATWGISLILQQTVRTIFGP 360

Query: 126 NYKPY--PTMLPSSPFEIGGAFITPTQILILGVTAVALASLVYLVNHTNLGRAMRATAEN 183
             +    P+ + S  FE+GG  IT  ++ I+       A+L++L+  T +G  MRA  +N
Sbjct: 361 TNREVGNPSWM-SGAFELGGLAITWNRLWIIVFALAVFAALLFLLKKTPMGLQMRAVTQN 419

Query: 184 PRVASLMGVKPDMVISATFIIGAVLAAIAGIMYASNYGTAQHTMGFLPGLKAFTAAVFGG 243
            R+AS MG++   V + TF +G+ +A IAG+   S        +G    + +F   VFGG
Sbjct: 420 RRMASSMGIRTPWVDALTFALGSGIAGIAGVA-LSQIDNVSPNLGQGYIIDSFMVVVFGG 478

Query: 244 IGNLAGAVVGGILLGLIEAIGSGYIGTLTGGLLGSHYTDIFAFIVLIIILTLRPSGL 300
           +GNL G +VG   LG++      Y G + G +L          +++I+ +  RP GL
Sbjct: 479 VGNLWGTLVGAFSLGILNKFLEPYAGAVLGKIL--------VLVLIILFIQKRPRGL 527


Lambda     K      H
   0.327    0.142    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 313
Number of extensions: 9
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 309
Length of database: 537
Length adjustment: 31
Effective length of query: 278
Effective length of database: 506
Effective search space:   140668
Effective search space used:   140668
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory