Align Putative amino-acid binding periplasmic protein (characterized, see rationale)
to candidate SMc02259 SMc02259 periplasmic binding ABC transporter protein
Query= uniprot:Q92PA9 (260 letters) >FitnessBrowser__Smeli:SMc02259 Length = 260 Score = 208 bits (530), Expect = 8e-59 Identities = 116/262 (44%), Positives = 157/262 (59%), Gaps = 6/262 (2%) Query: 1 MRISRRLAATASAAVFVLMAGVAMAEGEKVVIGTEGAYPPFNNLESDGTLTGFDIDIAKA 60 M+ + +L A A AA+ + A A A+ KV I E YPPF + ++ G G++I+ KA Sbjct: 1 MKKTLKLVALA-AALAITGAATASAQQVKVGIAAE-PYPPFTSPDASGNWEGWEIEFMKA 58 Query: 61 LCEEMKAECTFVTQDWDGIIPALIAKKFDAIVASMSITEERKQQVDFTNKYYNTPPAIVV 120 +C E K +C WDGIIPAL +KK D I+ SMSIT ER + +DF++KYYNTP I+ Sbjct: 59 MCAEAKLDCVVTPVAWDGIIPALTSKKIDMIIGSMSITAERLKTIDFSDKYYNTPTGIIG 118 Query: 121 PKDSPITEATAAALSGKALGAQGSTTHSNYAEAHMKES--EVKLYPTADEYKLDLANGRI 178 K I + T L+GK +G Q ST H YA H + EVK Y T DE DLA GR+ Sbjct: 119 AKGDDI-KPTPEGLAGKTIGVQVSTVHQAYAMKHFAPAGVEVKEYQTQDEANQDLAAGRV 177 Query: 179 DAAIDDVVVLSEWLKTEDG-ACCKLLGTLPIDPVINGEGAGIAIRKGDDALREKLNKAIE 237 DA D + L +LK++ G CC G + D + G G G+ +RKG+ L+EK+N AI+ Sbjct: 178 DAVQADAIALDAFLKSDQGKQCCDYKGEVAEDVDVIGPGVGVGLRKGETELKEKVNAAIK 237 Query: 238 AIRANGKYKQINEKYFPFDVYG 259 AIR NG Y ++KYF FD+YG Sbjct: 238 AIRENGTYDAFSKKYFDFDIYG 259 Lambda K H 0.315 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 224 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 260 Length adjustment: 24 Effective length of query: 236 Effective length of database: 236 Effective search space: 55696 Effective search space used: 55696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory