Align Amino acid ABC transporter, membrane protein (characterized, see rationale)
to candidate SMc00138 SMc00138 amino acid ABC transporter permease
Query= uniprot:Q88GX2 (236 letters) >FitnessBrowser__Smeli:SMc00138 Length = 276 Score = 271 bits (693), Expect = 1e-77 Identities = 133/224 (59%), Positives = 169/224 (75%) Query: 12 DPDLLERYGPRFIDGLLVTAKLVAISFSLGAVLGLLLALARLSRSLVLQRMAAGYVYFFR 71 DP+ RYGP F+ GL VT LV S +GAVL L +AL R+S++ + +A YVYFFR Sbjct: 51 DPEKFSRYGPSFLSGLGVTLTLVISSILMGAVLSLPVALGRMSKNRLWGWLAYAYVYFFR 110 Query: 72 GSPLLAQLFLLYYGLGSLKGFWQDVGLWWFFRDAWFCTLLAFTLNTAAYQAEIFRGSLMA 131 G+PL+ QLFL+YYGLGS + + VGLWWFFRDAW C L FTLNTAAYQAEI RG++ + Sbjct: 111 GTPLITQLFLIYYGLGSFRPQLETVGLWWFFRDAWNCALFTFTLNTAAYQAEILRGAIES 170 Query: 132 VAPGQHEAARALNLKRSTTFFKVILPQSLLVAIGPLGNELILMIKASAIASLVTIYDLMG 191 V GQ E A AL L FFKVILPQ+++VA+ P GNE+ILMIK SAI ++VT++DLMG Sbjct: 171 VPRGQREGAAALGLPERVAFFKVILPQAMIVALRPYGNEIILMIKGSAIVAIVTVFDLMG 230 Query: 192 VTKLAFSRSFDFQIYLWAAVLYLVIVELVRRLLKHLEARLGRHL 235 T+ AFSR+FD+Q+Y+WAA+LYL++VEL+R + LEARL RHL Sbjct: 231 ETRRAFSRTFDYQMYIWAAILYLLMVELLRNIWGWLEARLTRHL 274 Lambda K H 0.331 0.144 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 276 Length adjustment: 24 Effective length of query: 212 Effective length of database: 252 Effective search space: 53424 Effective search space used: 53424 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory