Align ABC transporter for L-Lysine, permease component 2 (characterized)
to candidate SMc02257 SMc02257 ABC transporter permease
Query= reanno::pseudo5_N2C3_1:AO356_09910 (229 letters) >FitnessBrowser__Smeli:SMc02257 Length = 274 Score = 162 bits (410), Expect = 6e-45 Identities = 85/222 (38%), Positives = 128/222 (57%), Gaps = 4/222 (1%) Query: 1 MNWDVIIKWLPKLAQGATLTLELVAIAVIAGLLLAIPLGIARSSRLWQVRALPYAYIFFF 60 M WD + ++LP+L G ++L ++ I G LLA+PLG+A+ + W +A + Sbjct: 45 MRWDWLPRYLPRLGSGILVSLAMLFSTAILGFLLAVPLGLAQVTGPWFFKAPARIFCTVI 104 Query: 61 RGTPLLVQLFLVYYGLA----QFDAVRSSALWPYLRDPFWCATVTMTLHTAAYIAEILRG 116 RGTPLL+QL+L+YYGL QF A+R S LWPYLR+ + +T+ AAY E++RG Sbjct: 105 RGTPLLLQLWLLYYGLGSLFPQFPAIRQSFLWPYLREAWPYGVAALTVSFAAYEGEVMRG 164 Query: 117 AIQAIPKGEIEAARALGMSRPKALFYIMLPRAARIGLPAYSNEVILMLKASALASTVTLL 176 A +P GE+EAARA GM R I LPRA LP + E +L LK++ L +T+T++ Sbjct: 165 AFAGVPSGELEAARAYGMGRWTMFRRIWLPRAIHRALPTLNGETVLQLKSTPLVATITVV 224 Query: 177 ELTGMARTIIARTYLPVEIFFAAGMFYLLMSFLLVQGFKQLE 218 ++ + + TYL E Y+ ++ +LV F+ E Sbjct: 225 DVYAVISKVRQETYLTYEPLLLLAAIYMCLTAILVVAFRYFE 266 Lambda K H 0.331 0.141 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 229 Length of database: 274 Length adjustment: 24 Effective length of query: 205 Effective length of database: 250 Effective search space: 51250 Effective search space used: 51250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory