Align Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale)
to candidate SMa0489 SMa0489 ABC transporter ATP-binding protein
Query= uniprot:Q88GX0 (260 letters) >FitnessBrowser__Smeli:SMa0489 Length = 255 Score = 305 bits (781), Expect = 6e-88 Identities = 150/244 (61%), Positives = 184/244 (75%) Query: 16 PRPVLIRIEGLNKHYGAFHVLRDIDLQVREGERIVLCGPSGSGKSTLIRCINRLEVAQQG 75 P +I++ G+ K +G F L+ + L+VR GE+IVLCGPSGSGKSTLIRCINR+E G Sbjct: 10 PNDTMIQLIGVGKRFGQFEALKQVSLEVRRGEKIVLCGPSGSGKSTLIRCINRMEEHTSG 69 Query: 76 SIQVDGIDLAATTREAAQVRSDIGMVFQHFNLFPHMSVLDNCLLAPTSVRGLSRKDAEER 135 I +DG +L T++ VR ++GMVFQ FNLFPHM++L N +A VR K+A+E Sbjct: 70 RIIIDGRELTDRTKDINAVRREVGMVFQSFNLFPHMTILKNLTIAQRLVRKTPEKEAKEV 129 Query: 136 ARMYLSKVGIESQAHKYPSQLSGGQQQRVAIARALCMKPRIMLFDEPTSALDPEMVAEVL 195 A YL +V I QA KYP QLSGGQQQRVAIARALCMKP+IMLFDEPTSALDPEM++EVL Sbjct: 130 AMHYLKRVKIPEQASKYPVQLSGGQQQRVAIARALCMKPQIMLFDEPTSALDPEMISEVL 189 Query: 196 DVLVQLAGTGMTMLCVTHEMGFARQVAERVLFLEGGQIIEDSPPQVFFNQPRTERAKAFL 255 DV+V LA GMTM+CVTHEMGFAR VA+RV+F++GGQ+IE+ P+ FF PR ER FL Sbjct: 190 DVMVDLARDGMTMICVTHEMGFARSVADRVMFMDGGQLIEEGDPETFFANPRNERTALFL 249 Query: 256 AQIL 259 QIL Sbjct: 250 RQIL 253 Lambda K H 0.322 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 233 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 255 Length adjustment: 24 Effective length of query: 236 Effective length of database: 231 Effective search space: 54516 Effective search space used: 54516 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory