Align Amino acid ABC transporter, membrane protein (characterized, see rationale)
to candidate SMc00138 SMc00138 amino acid ABC transporter permease
Query= uniprot:Q88GX3 (239 letters) >FitnessBrowser__Smeli:SMc00138 Length = 276 Score = 116 bits (291), Expect = 4e-31 Identities = 75/221 (33%), Positives = 123/221 (55%), Gaps = 3/221 (1%) Query: 15 WGQALLAGALVTVSLALACLPIGLPLGLVVALAARSRKRLPRAWATTFSTVFRGLPELLT 74 +G + L+G VT++L ++ + +G L L VAL S+ RL A + FRG P + Sbjct: 58 YGPSFLSGLGVTLTLVISSILMGAVLSLPVALGRMSKNRLWGWLAYAYVYFFRGTPLITQ 117 Query: 75 LLIIYYGCQIAAQKILAAMGYQGEFLINTFLAAMIAFSLVFAAFSSEIWLAAFKTLPKGQ 134 L +IYYG + + L +G F + + A+ F+L AA+ +EI A +++P+GQ Sbjct: 118 LFLIYYGLG-SFRPQLETVGLWW-FFRDAWNCALFTFTLNTAAYQAEILRGAIESVPRGQ 175 Query: 135 LEACSALGLSKRTGFFKVLLPQLTRIALPGLSNNWLSLLKDTSLVSTISLVDLMRQTNLA 194 E +ALGL +R FFKV+LPQ +AL N + ++K +++V+ +++ DLM +T A Sbjct: 176 REGAAALGLPERVAFFKVILPQAMIVALRPYGNEIILMIKGSAIVAIVTVFDLMGETRRA 235 Query: 195 VSVTKEPMFFYGVACLGYLLFAALSGRVFAYIERRSNRHLQ 235 S T + + A L YLL L ++ ++E R RHL+ Sbjct: 236 FSRTFDYQMYIWAAIL-YLLMVELLRNIWGWLEARLTRHLK 275 Lambda K H 0.328 0.139 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 239 Length of database: 276 Length adjustment: 24 Effective length of query: 215 Effective length of database: 252 Effective search space: 54180 Effective search space used: 54180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory