Align Amino acid ABC transporter, membrane protein (characterized, see rationale)
to candidate SMc00139 SMc00139 amino acid ABC transporter permease
Query= uniprot:Q88GX3 (239 letters) >FitnessBrowser__Smeli:SMc00139 Length = 267 Score = 226 bits (577), Expect = 3e-64 Identities = 115/227 (50%), Positives = 156/227 (68%) Query: 6 SLLSFASGGWGQALLAGALVTVSLALACLPIGLPLGLVVALAARSRKRLPRAWATTFSTV 65 +LL+ GWG + G LVT SLA+A LP+GL +G VALA +S ++ R ++T+ Sbjct: 36 TLLACGDAGWGDEIAYGFLVTASLAVATLPVGLVIGFFVALAKQSEEKSLRLAGNIYTTI 95 Query: 66 FRGLPELLTLLIIYYGCQIAAQKILAAMGYQGEFLINTFLAAMIAFSLVFAAFSSEIWLA 125 FRGLPELLTL I+YYG QI Q+ LA +GY+G IN F+A MIA +VF+A+ SE+ L+ Sbjct: 96 FRGLPELLTLFIVYYGLQILVQQFLATVGYEGAVEINAFVAGMIALGVVFSAYCSEVLLS 155 Query: 126 AFKTLPKGQLEACSALGLSKRTGFFKVLLPQLTRIALPGLSNNWLSLLKDTSLVSTISLV 185 AFK +P GQ EA ALGL + ++LPQL RIALPGL N W++LLKDT+LVS I L Sbjct: 156 AFKAIPHGQYEAGDALGLHRGKTMRLIILPQLIRIALPGLGNLWMALLKDTALVSVIGLP 215 Query: 186 DLMRQTNLAVSVTKEPMFFYGVACLGYLLFAALSGRVFAYIERRSNR 232 D++RQT +A VTK F+G+AC+ +L+ A +S VF+ +ER + R Sbjct: 216 DILRQTGIAARVTKHAFEFFGIACVLFLVLAMISSVVFSALERSTKR 262 Lambda K H 0.328 0.139 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 182 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 239 Length of database: 267 Length adjustment: 24 Effective length of query: 215 Effective length of database: 243 Effective search space: 52245 Effective search space used: 52245 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory