Align lysine 6-dehydrogenase (EC 1.4.1.18) (characterized)
to candidate SMc02503 SMc02503 hypothetical protein
Query= BRENDA::Q3S559 (368 letters) >FitnessBrowser__Smeli:SMc02503 Length = 367 Score = 372 bits (954), Expect = e-107 Identities = 190/354 (53%), Positives = 238/354 (67%), Gaps = 3/354 (0%) Query: 8 ITVLGAGKIGFAIALLLQRTGDYAVCVADQDPSRLDAVA---ALGCQTAQIDNDAALEAA 64 I V+GAGKIG IA +L +GDY VCVAD+ +L V A+ I + AL A Sbjct: 4 IVVIGAGKIGSTIARMLAHSGDYRVCVADRSAEQLQQVEKHDAVSTAVVDIADRKALVAL 63 Query: 65 IAGRHAVLNALPFHRAVAVAGLCARLGVHYFDLTEDVASTHAIHALGRDARAVLMPQCGL 124 ++G+ AVL+A PFH VA+A A +HY DLTEDV ST + A+ +AR +PQCGL Sbjct: 64 LSGKFAVLSAAPFHLTVAIAEAAAEAEIHYLDLTEDVESTRQVKAIAAEARTAFIPQCGL 123 Query: 125 APGFIGIVGNDLARRFDTLLDLRMRVGGLPRYPTNALRYNLYLEHRGADQRVLQSMRGAV 184 APGFI IV NDL+R FDTL +RMRVG LP+YP+NAL YNL G ++ V Sbjct: 124 APGFISIVANDLSRHFDTLESVRMRVGALPQYPSNALNYNLTWSTDGVINEYIEPCEAIV 183 Query: 185 DGELVKVPPMEGYETFTLDGVEYEAFNTSGGLGTLPQTLLGKARNVDYKSVRYPGHCAIM 244 +G L++VP ME E F+LDGV YEAFNTSGGLGTL +TL GK R ++YK++RYPGH AI Sbjct: 184 EGSLIEVPAMEEREEFSLDGVTYEAFNTSGGLGTLCETLKGKVRTLNYKTIRYPGHAAIF 243 Query: 245 KLLLNDLRLRERRELLQDILESAIPATGQDVIVILATASGYRGGRLLQEAYSAHIHGDTV 304 K LLNDL LR RRE+L+DILE+A+P T QDV+VI T SG+R GRL+QE Y+ ++ V Sbjct: 244 KALLNDLGLRHRREVLKDILENALPTTTQDVVVIFVTVSGFREGRLVQETYANKVYSGVV 303 Query: 305 DGHALSAIQLSTAAGICTALDLVVEGALPQRGFVGQESIPLDALLANRHGRIYA 358 G S IQ++TA IC LD++ EG +P +GFV QE I LD LANR G YA Sbjct: 304 AGRMQSGIQITTAGSICAVLDMLAEGKIPTKGFVRQEDIALDTFLANRFGHYYA 357 Lambda K H 0.323 0.139 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 352 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 368 Length of database: 367 Length adjustment: 30 Effective length of query: 338 Effective length of database: 337 Effective search space: 113906 Effective search space used: 113906 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory