GapMind for catabolism of small carbon sources

 

Aligments for a candidate for lysL in Sinorhizobium meliloti 1021

Align L-lysine transport protein (characterized)
to candidate SMa1668 SMa1668 ArcD2 arginine/ornithine antiporter

Query= CharProtDB::CH_019644
         (501 letters)



>lcl|FitnessBrowser__Smeli:SMa1668 SMa1668 ArcD2 arginine/ornithine
           antiporter
          Length = 473

 Score =  371 bits (953), Expect = e-107
 Identities = 199/487 (40%), Positives = 295/487 (60%), Gaps = 17/487 (3%)

Query: 17  SRTVSIRTLIALIIGSTVGAGIFSIPQNIGSVAGPGAMLIGWLIAGVGMLSVAFVFHVLA 76
           ++ +S+  L  +++GS VGAGIFS+P+  G   GP   +I W IAG GM  +A VF  LA
Sbjct: 2   AQKLSLFALTGMVVGSMVGAGIFSLPRTFGVATGPFGAIIAWCIAGGGMYMLARVFQSLA 61

Query: 77  RRKPHLDSGVYAYARVGLGDYVGFSSAWGYWLGSVIAQVGYATLFFSTLGHYVPLFSQDH 136
            RKP LD+GV+AYA+ G GDY GF SA+GYW+GS I  V Y  L  STLG++ P+F   +
Sbjct: 62  ERKPDLDAGVFAYAKEGFGDYPGFLSAFGYWIGSCIGNVSYWVLIKSTLGNFFPVFGDGN 121

Query: 137 PFVSALAVSALTWLVFGVVSRGISQAAFLTTVTTVAKILPLLCFIILVAFLGFSWEKFTV 196
             V+ L  S   WL   ++ RGI QAAF+ TV TVAK++P++ FII++ F  F  + F +
Sbjct: 122 TVVAILFASVGIWLFHFMILRGIQQAAFVNTVVTVAKVIPIIAFIIILFFF-FKLDLFRL 180

Query: 197 DLWARDG-GVGSIFDQVRGIMVYTVWVFIGIEGASVYSRQARSRSDVSRATVIGFVAVLL 255
           + W  +G    ++  Q++  M+ TV+VFIGIEGAS YSR A++RSD+  AT++GF+ V  
Sbjct: 181 NFWGGEGMPEATLLQQIQATMLATVFVFIGIEGASNYSRYAQARSDIGTATIMGFIGVSA 240

Query: 256 LLVSISSLSFGVLTQQELAALPDNSMASVLEAVVGPWGAALISLGLCLSVLGAYVSWQML 315
           L+V ++ L +  LT+ E+AA+   SMA VL AVVGPWGA  IS+G+ +SVLGAY++W ++
Sbjct: 241 LMVLVTLLPYAALTRPEIAAMSQPSMAGVLAAVVGPWGAVFISIGVIVSVLGAYLAWSLV 300

Query: 316 CAEPLALMAMDGLIPSKIGAINSRGAAWMAQLISTIVIQIFIIIFFLNETTYVSMVQLAT 375
           CAE L + A    +P   G  N       A  ++ IV+Q+F+I  + ++  +  M+ L +
Sbjct: 301 CAEVLYVAARTDDMPRLFGTENQNKVPAAALWLTNIVVQLFVISTYWSQDAFALMLNLTS 360

Query: 376 NLYLVPYLFSAFYLVMLATRGKGITHPHAGTRFDDSGPEISRRENRKHLIVGLVATVYSV 435
           ++ L+PY+F A +  MLA R +                E+  RE  + LI+  +A VY+ 
Sbjct: 361 SMSLIPYMFVAAFGFMLAQRAETY--------------EVRPRERTRDLIIASIAAVYTF 406

Query: 436 WLFYAAEPQFVLFGAMAMLPGLIPYVWTRIYRGEQVFN-RFEIGVVVVLVVAASAGVIGL 494
           ++  A   +FVL  A+   PG I Y W R  RG++VFN   +  +    V+   A +IGL
Sbjct: 407 FMIVAGGIKFVLLSALLYAPGTILYFWARRERGKRVFNTSIDWLIFATAVIGCFAAIIGL 466

Query: 495 VNGSLSL 501
             G L++
Sbjct: 467 STGYLTI 473


Lambda     K      H
   0.327    0.139    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 676
Number of extensions: 43
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 501
Length of database: 473
Length adjustment: 34
Effective length of query: 467
Effective length of database: 439
Effective search space:   205013
Effective search space used:   205013
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory