Align 2-aminoadipate transaminase (EC 2.6.1.39) (characterized)
to candidate SMc02138 SMc02138 acetylornithine transaminase
Query= reanno::Putida:PP_4108 (416 letters) >FitnessBrowser__Smeli:SMc02138 Length = 399 Score = 205 bits (522), Expect = 2e-57 Identities = 146/404 (36%), Positives = 208/404 (51%), Gaps = 41/404 (10%) Query: 15 PITLSHGRNAEVWDTDGKRYIDFVGGIGVLNLGHCNPAVVEAIQAQATRLTHYAFNAAPH 74 P+ G + DG RY+DF G+ V +LGH +P +VEA++AQA ++ H + N Sbjct: 15 PLRFERGEGVWLIAEDGTRYLDFAAGVAVNSLGHAHPHLVEALKAQADKVWHLS-NLYEI 73 Query: 75 GPYLALMEQLSQFVPVSYPLAGMLTNSGAEAAENALKVAR------GATGKRAIIAFDGG 128 +L +L+Q V++ TNSGAEA E A+K AR G K +I F+G Sbjct: 74 AGQESLARRLTQ---VTFADRVFFTNSGAEALECAIKTARRYHFAKGHVEKFHVITFEGA 130 Query: 129 FHGRTLATLNLNGKVAPYKQRVGELPGPVYHLPYPSADTGVTCEQALKAMDRLFSVELAV 188 FHGRTLAT+ G+ Y + G Y +P+ D G +V+ A+ Sbjct: 131 FHGRTLATIAAGGQ-QKYIEGFGPKAPGFYQVPF--GDIG--------------AVKNAI 173 Query: 189 -EDVAAFIFEPVQGEGGFLALDPAFAQALRRFCDERGILIIIDEIQSGFGRTGQRFAFPR 247 E+ AA + EP+QGEGG F Q LR CDE G+L+I+DE+QSG GRTG+ FA Sbjct: 174 NEETAAILVEPIQGEGGIRTASKEFMQGLRELCDEFGLLLILDEVQSGVGRTGKLFAHEW 233 Query: 248 LGIEPDLLLLAKSIAGGMPLGAVVGRKELMAALPKGGLGGTYSGNPISCAAALASLAQMT 307 GI+PD++ +AK I GG PLGA + + A + G G TY GNP++ A A L + Sbjct: 234 AGIKPDIMAVAKGIGGGFPLGACLATEAAAAGMVAGTHGSTYGGNPLAMAVGNAVLDVVL 293 Query: 308 DENLATWGERQEQAIVSRYERWKASGLSP-YIGRLTGVGAMRGIEFANADGSPAPAQLAK 366 E + +E A+V R P I + G G M GI+ A A Sbjct: 294 AEGFL--DQVREVALVFRQGLASLKDRFPDVIEEIRGDGLMLGIK--------AKVPSAD 343 Query: 367 VMEAARARGLLLMPSGKARHIIRLLAPLTIEAEVLEEGLDILEQ 410 +++A RA LL++P+G+ +++RLL PL EGL LE+ Sbjct: 344 LLKAIRAEKLLVVPAGE--NVLRLLPPLITTPAEAREGLARLER 385 Lambda K H 0.320 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 418 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 399 Length adjustment: 31 Effective length of query: 385 Effective length of database: 368 Effective search space: 141680 Effective search space used: 141680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory