Align Maltose-transporting ATPase (EC 3.6.3.19) (characterized)
to candidate SMc01978 SMc01978 sugar transport system permease ABC transporter protein
Query= reanno::Koxy:BWI76_RS01825 (514 letters) >FitnessBrowser__Smeli:SMc01978 Length = 311 Score = 122 bits (305), Expect = 2e-32 Identities = 88/243 (36%), Positives = 129/243 (53%), Gaps = 20/243 (8%) Query: 259 IGWDNFTRVFQDEGIQKPFFAIFVWTVVFSVLTVILTVAVGMVLACLVQWEALKGKAIYR 318 +G D+F + QD+ FF T+ ++ +V L A G++LA L+ + G+AI + Sbjct: 68 VGLDHFRALAQDQA----FFRSLRNTLWWTGASVFLQFAFGLILALLLD-KPFHGRAIAQ 122 Query: 319 VLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGIKPA---WFSDPTTARTMIIIV 375 L+ LP+AVPSF++ L + LFN G + L AL GI SDP A I+ Sbjct: 123 ALVFLPWAVPSFLAGLNWAWLFNPVVGPLPHWLFAL-GIMSQPTNILSDPQLAMWGPIVA 181 Query: 376 NTWLGYPYMMILCMGLLKAIPDDLYEASAMDGATPFQNFFKITLPLLIKPLTPLMIASFA 435 N W G P+ I + L+AIP DLYEA+++DGA P Q F ITLP L + ++ Sbjct: 182 NIWWGIPFFAITLLAALQAIPRDLYEAASIDGAGPLQRFLSITLPFLAPTIAITILLRTV 241 Query: 436 FNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVSYTYRIAFEGGGGQDFGLAAAIATLIF 495 + N LI ++TNGG PA T ++ SY + AF+ DFG A+AIA ++ Sbjct: 242 WISNFADLIIVMTNGG--------PADRTQIVASYIFTQAFK---RLDFGYASAIALVLL 290 Query: 496 LLV 498 L+ Sbjct: 291 ALL 293 Lambda K H 0.325 0.140 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 514 Length of database: 311 Length adjustment: 31 Effective length of query: 483 Effective length of database: 280 Effective search space: 135240 Effective search space used: 135240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory