Align Binding-protein-dependent transport systems inner membrane component (characterized, see rationale)
to candidate SM_b21459 SM_b21459 sugar uptake ABC transporter permease
Query= uniprot:C8WUR0 (321 letters) >FitnessBrowser__Smeli:SM_b21459 Length = 297 Score = 134 bits (338), Expect = 2e-36 Identities = 95/311 (30%), Positives = 156/311 (50%), Gaps = 35/311 (11%) Query: 7 MRRSHGRERAKRRVDWVAYGYLSPALVTICVLSILPIFYTIYISFTNFNQMHFLSYQFVG 66 M + ER +RR W+ +L P L+T+ ++I P+ +I+ SFT+ Y FVG Sbjct: 1 MNAARRMERQQRRTAWI---FLLPLLLTLMAVAIWPLARSIFFSFTDAYLDAPSDYGFVG 57 Query: 67 LKNYEELLNPHDPLSNLFLPTFIWTLVYALCTTALAYLVGLFLAVLLNNKHMRERTLYRT 126 ++N+ E+ DP+ F TLV+ L + L L+GL +A+LL+ + R + R Sbjct: 58 IENFVEVAE--DPV---FWGAVRNTLVFTLVSVGLETLLGLAIALLLHRAFLG-RGIVRA 111 Query: 127 LLIVPWAVPNLISMLAWQGLLNDQYGQINALLHGVFGLPR-IPWLTSALWARIAVIMVNV 185 +++PWA+P ++S W+ +LNDQ+G IN LL + + + + W VI ++V Sbjct: 112 AILIPWAMPMVVSARIWEWMLNDQFGLINKLLVALGLVEKGVAWTADPSLILGTVIFIDV 171 Query: 186 WAGFPYMMTVCLGALQSIPTDQYEAAEIDGANWWQVFRYVTMPSVWRISLPLLIPSFSY- 244 W P+M+ + L LQ IP + YEAA++ G W+ F W I+LPL P+ Sbjct: 172 WVTTPFMVLLILAGLQLIPEEIYEAADVSGVPQWKRF--------WSITLPLATPAIGVA 223 Query: 245 -------NFNNFNASYLLTGGGPPNSNNPFLGQTDILATAAYKMTLTFNRYDLGATISVL 297 F+ SY+L N+ N T ++ A ++F LGA S Sbjct: 224 ILFRTLDALRMFDLSYVLAA----NNEN-----TMTMSIYARDQLISFQDLGLGAAASTW 274 Query: 298 LFILVALISWV 308 +F+++ LI+ V Sbjct: 275 VFMIIGLIAIV 285 Lambda K H 0.327 0.140 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 308 Number of extensions: 26 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 297 Length adjustment: 27 Effective length of query: 294 Effective length of database: 270 Effective search space: 79380 Effective search space used: 79380 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory