Align MalF, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate SMc01978 SMc01978 sugar transport system permease ABC transporter protein
Query= TCDB::Q8DT27 (453 letters) >FitnessBrowser__Smeli:SMc01978 Length = 311 Score = 105 bits (263), Expect = 2e-27 Identities = 84/279 (30%), Positives = 136/279 (48%), Gaps = 15/279 (5%) Query: 162 LIGVLLFTILPLVYMICLAFTNYDHNHLPPKSLFDWVGLANFGNVLNGRMAGTFFPVLSW 221 LI ++ ++PLV I AF D L P S +VGL +F + + FF L Sbjct: 35 LILIVTVMLVPLVLGISYAFR--DIQLLNPFS-GGFVGLDHFRALAQDQ---AFFRSLRN 88 Query: 222 TLIWAVFATVTNFLFGVILALIINAKGLKLKKMWRTIFVITIAVPQFISLLLMRNFLNDQ 281 TL W + F FG+ILAL+++ K + + + + + AVP F++ L N Sbjct: 89 TLWWTGASVFLQFAFGLILALLLD-KPFHGRAIAQALVFLPWAVPSFLAGLNWAWLFNPV 147 Query: 282 -GPLNAFLEKIGLISHSLPFLSDPTWAKFSIIFVNMWVGIPFTMLVATGIIMNLPSEQIE 340 GPL +L +G++S LSDP A + I N+W GIPF + + +P + E Sbjct: 148 VGPLPHWLFALGIMSQPTNILSDPQLAMWGPIVANIWWGIPFFAITLLAALQAIPRDLYE 207 Query: 341 AAEIDGASKFQIFKSITFPQILLIMMPSLIQQFIGNINNFNVIYLLTGGGPTNSQFYQAG 400 AA IDGA Q F SIT P + + +++ + + N ++I ++T GGP A Sbjct: 208 AASIDGAGPLQRFLSITLPFLAPTIAITILLRTVWISNFADLIIVMTNGGP-------AD 260 Query: 401 STDLLVTWLYKLTMNAADYNLASVIGIFIFAISAIFSLL 439 T ++ ++++ D+ AS I + + A+ +SLL Sbjct: 261 RTQIVASYIFTQAFKRLDFGYASAIALVLLALLLAYSLL 299 Lambda K H 0.329 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 377 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 453 Length of database: 311 Length adjustment: 30 Effective length of query: 423 Effective length of database: 281 Effective search space: 118863 Effective search space used: 118863 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory