Align Maltose-transporting ATPase (EC 3.6.3.19) (characterized)
to candidate SMc04137 SMc04137 ABC transporter permease
Query= reanno::Koxy:BWI76_RS01820 (296 letters) >FitnessBrowser__Smeli:SMc04137 Length = 295 Score = 138 bits (348), Expect = 1e-37 Identities = 90/285 (31%), Positives = 150/285 (52%), Gaps = 19/285 (6%) Query: 14 FTTHLLLLVFIAAIMFPLLMVIAISLREGN--FATGSLIPESISWEHWRLALGFSVEHAD 71 F H L+ A+++PLL +I+ S+R + FA+ SL P S+ + + + F ++ + Sbjct: 26 FLVHAALIAASIAMIYPLLWMISASVRPEDEIFASTSLWPSSVDFSSY-VRGWFGLDVSF 84 Query: 72 GRVTPPPFPVLLWLWNSIKVAGITAIGIVALSTTCAYAFARMRFPGKATLLKGMLIFQMF 131 GR + WNS+ +A +T +G V + AYAFAR+RF G+ ML M Sbjct: 85 GR----------FFWNSLVIAVLTVVGNVVACSLAAYAFARLRFAGRNFWFAIMLGTMMI 134 Query: 132 PAVLSLVALYALFDRLGQYVPFVGLNTHGGVIFAYMGGIALHVWTIKGYFETIDGSLEEA 191 P ++L+ Y LF LG F+ L V+ ++ A ++ + +F I L+EA Sbjct: 135 PYHVTLIPQYVLFLDLGWVNTFLPL-----VVPKFLASDAFFIFLMVQFFRGIPRELDEA 189 Query: 192 AALDGATPWQAFRLVLLPLSVPILAVVFILSFIAAITEVPVASLLLRDVNSYTLAVGMQQ 251 A +DG W+ + ++LPLS+P+LA I SFI + + L D+NSYT+ +G++ Sbjct: 190 AMMDGCGAWRIYWKIMLPLSLPVLATAAIFSFIWTWDDFFGPLIYLNDMNSYTIQLGLRT 249 Query: 252 YLNPQNYL-WGDFAAAAVLSAIPITVVFLLAQRWLVNGLTAGGVK 295 +++ + WG A + LS +P+ FL QR L+ G+ G+K Sbjct: 250 FVDSSSTSDWGGLFAMSTLSLVPVFFFFLFFQRLLIEGIATTGMK 294 Lambda K H 0.328 0.141 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 268 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 295 Length adjustment: 26 Effective length of query: 270 Effective length of database: 269 Effective search space: 72630 Effective search space used: 72630 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory