Align ABC-type Maltose/ Maltodextrin permease (characterized, see rationale)
to candidate SM_b21105 SM_b21105 sugar ABC transporter permease
Query= uniprot:Q6MNM1 (272 letters) >FitnessBrowser__Smeli:SM_b21105 Length = 288 Score = 168 bits (425), Expect = 1e-46 Identities = 86/276 (31%), Positives = 150/276 (54%), Gaps = 5/276 (1%) Query: 2 LKKTFSWISILLFSLFSIYPILYVLSVSLRPDNAFQTQSLEIIGPNASFKNFVDLFATTD 61 L K + L L P L+++ SLRP + I S + +F+ Sbjct: 13 LLKVAHLAGLFLAMLVICLPGLWIVLSSLRPTVEIMAKPPVWIPETLSLDAYRAMFSGAG 72 Query: 62 ---FLIW--MRNSLVVSAATTLLGVALASTSAYALARYRFRGRNMMLFSLLMTQMFPATM 116 +W RNSL+VS +T++ +A+ + YA ARYRF+ ++ + ++T+ P Sbjct: 73 QGGVPVWDYFRNSLIVSVTSTVIALAIGLSGGYAFARYRFKAKSAIFLGFMLTRAVPGIA 132 Query: 117 LMLPFYIILSKLRLIDSFWGLFLIYSSTALPFCIWQMKAYYDTIPRELEEAALLDGCSKW 176 L LP +++ ++ +ID+ + L L Y + +PF IW + ++ +P++L EAA +DGC+ W Sbjct: 133 LSLPLFMLYARTGIIDTHFSLILTYVALNVPFTIWLIDGFFRQVPKDLAEAAQIDGCTPW 192 Query: 177 MIFYKIILPVSSPALVITALFSFMSSWSEYVIAAVVLQDPQLYTLPLGLRSFQASLATQW 236 F+++ P++ P + +F+F++SW+EY +A+ + + TLP+GL + A W Sbjct: 193 QAFWQVEFPLAGPGIASAGIFAFLTSWNEYALASQITRSVNSKTLPVGLLDYTAEFTIDW 252 Query: 237 GLYAAGALIVSVPVLILFISISRYLVSGLTMGSVKG 272 A A+++ VP L L I ++LVSGLT G+VKG Sbjct: 253 RGMCALAVVMIVPALTLTFIIQKHLVSGLTFGAVKG 288 Lambda K H 0.329 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 205 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 288 Length adjustment: 26 Effective length of query: 246 Effective length of database: 262 Effective search space: 64452 Effective search space used: 64452 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory