Align ABC-type Maltose/ Maltodextrin permease (characterized, see rationale)
to candidate SMc01979 SMc01979 sugar transport system permease ABC transporter protein
Query= uniprot:Q6MNM1 (272 letters) >FitnessBrowser__Smeli:SMc01979 Length = 277 Score = 199 bits (506), Expect = 5e-56 Identities = 94/264 (35%), Positives = 171/264 (64%) Query: 9 ISILLFSLFSIYPILYVLSVSLRPDNAFQTQSLEIIGPNASFKNFVDLFATTDFLIWMRN 68 +++L + F+++P+ ++L V++ P++ ++ + + AS ++F + + F ++ RN Sbjct: 14 LAVLAYIAFALFPLFWLLKVAVTPNDLLYSEGIRLWPSRASLEHFDFVLRHSAFPVFFRN 73 Query: 69 SLVVSAATTLLGVALASTSAYALARYRFRGRNMMLFSLLMTQMFPATMLMLPFYIILSKL 128 SL+VS +T ++ LAS S YAL+R+RFRG+ ++ +L+TQMFP ML+ P + ILS L Sbjct: 74 SLIVSGSTAVIVTILASLSGYALSRFRFRGKYWLVTLMLLTQMFPLVMLVAPIFKILSPL 133 Query: 129 RLIDSFWGLFLIYSSTALPFCIWQMKAYYDTIPRELEEAALLDGCSKWMIFYKIILPVSS 188 L +S GL ++Y++ +PF + M++++D IP++LEEAA++DG ++++ F +IILP++ Sbjct: 134 GLTNSLTGLVVVYTAFNVPFATFLMQSFFDGIPKDLEEAAMIDGATQFVAFRQIILPLTL 193 Query: 189 PALVITALFSFMSSWSEYVIAAVVLQDPQLYTLPLGLRSFQASLATQWGLYAAGALIVSV 248 P + T F F ++WSE + + +++ T P+GL SF + + +G A ++ + Sbjct: 194 PGIAATLGFVFTAAWSELLFSLMLISGNAQATFPVGLLSFVSKFSVDFGQMMAAGVLALI 253 Query: 249 PVLILFISISRYLVSGLTMGSVKG 272 P + F+ I RYLV GLT G+VKG Sbjct: 254 PACLFFLLIQRYLVQGLTAGAVKG 277 Lambda K H 0.329 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 277 Length adjustment: 25 Effective length of query: 247 Effective length of database: 252 Effective search space: 62244 Effective search space used: 62244 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory