Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate SM_b21106 SM_b21106 sugar ABC transporter ATP-binding protein
Query= BRENDA::Q70HW1 (384 letters) >FitnessBrowser__Smeli:SM_b21106 Length = 365 Score = 338 bits (868), Expect = 1e-97 Identities = 188/373 (50%), Positives = 254/373 (68%), Gaps = 14/373 (3%) Query: 1 MARVLLEHIYKTYPGQTEPTVKDFNLDIQDKEFTVFVGPSGCGKTTTLRMIAGLEDITEG 60 MA V L+ + K Y G E V +L+++D+EF VGPSGCGK+TTLRMIAGLE+++ G Sbjct: 1 MAPVTLKKLVKRY-GALE-VVHGIDLEVKDREFIALVGPSGCGKSTTLRMIAGLEEVSGG 58 Query: 61 NLYIGDRRVNDVPPKDRDIAMVFQNYALYPHMTVYQNMAFGLKLRKVPKAEIDRRVQEAA 120 + IG R+VND+PP+ R+I+MVFQ+YALYPHMTV +NM F LK+ P EI RV EAA Sbjct: 59 AIEIGGRKVNDLPPRARNISMVFQSYALYPHMTVAENMGFSLKIAGRPAEEIKTRVAEAA 118 Query: 121 KILDIAHLLDRKPKALSGGQRQRVALGRAIVREPQVFLMDEPLSNLDAKLRVQMRAEIRK 180 ILD+AHLL+R+P LSGGQRQRVA+GRAIVR+P VFL DEPLSNLDAKLR Q+R EI+K Sbjct: 119 AILDLAHLLERRPSQLSGGQRQRVAMGRAIVRQPDVFLFDEPLSNLDAKLRTQVRTEIKK 178 Query: 181 LHQRLQTTVIYVTHDQTEAMTMGDRIVVMRDGVIQQADTPQVVYSQPKNMFVAGFIGSPA 240 LH R+Q T+IYVTHDQ EAMT+ DRIV+MRDG I+Q TP+ V+ +P FVAGFIGSP Sbjct: 179 LHARMQATMIYVTHDQVEAMTLSDRIVIMRDGHIEQVGTPEDVFRRPATKFVAGFIGSPP 238 Query: 241 MNFIRGEIVQDGDAFYFRAPSISLRLPEGRYGVLKASGAIGKPVVLGVRPEDLHDE-EVF 299 MN + ++ DG + A +L LP +++ G+ V G+RP+D++ Sbjct: 239 MN-MEEAVLTDGKLAF--ASGATLPLPPRFRSLVRE----GQKVTFGLRPDDVYPSGHGL 291 Query: 300 MTTYPDSV--LQMQVEVVEHMGSEVYLHTSIGPNTIVAR-VNPRHVYHVGSSVKLAIDLN 356 D+V +++ V + E +G+E + T V+R +NPR + G +V ++ DL Sbjct: 292 HAGDADAVHEIELPVTITEPLGNETLVFTQFNGRDWVSRMLNPRPL-RPGEAVPMSFDLA 350 Query: 357 KIHIFDAETEESI 369 + H+FD ET ++ Sbjct: 351 RAHLFDGETGRAL 363 Lambda K H 0.321 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 415 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 365 Length adjustment: 30 Effective length of query: 354 Effective length of database: 335 Effective search space: 118590 Effective search space used: 118590 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory