Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate SM_b20419 SM_b20419 glycerol-3-phosphate ABC transporter ATP-binding protein
Query= BRENDA::Q8NMV1 (376 letters) >FitnessBrowser__Smeli:SM_b20419 Length = 349 Score = 310 bits (794), Expect = 4e-89 Identities = 169/321 (52%), Positives = 219/321 (68%), Gaps = 14/321 (4%) Query: 1 MATVTFKDASLSYPGAKEPTVKKFNLEIADGEFLVLVGPSGCGKSTTLRMLAGLENVTDG 60 MAT+T KD +Y G ++ +L IADGEF+VLVGPSGCGKST LRM+AGLE++T G Sbjct: 1 MATITLKDVHKTYHG-DIAAIRGVSLAIADGEFIVLVGPSGCGKSTLLRMIAGLESITSG 59 Query: 61 AIFIGDKDVTHVAPRDRDIAMVFQNYALYPHMTVGENMGFALKIAGKSQDEINKRVDEAA 120 I IGD+ V + P +RDIAMVFQNYALYPHMTV +N+ + LK ++EI +R+ +AA Sbjct: 60 EISIGDRVVNGLEPSERDIAMVFQNYALYPHMTVRQNLSYGLKNRNTPKEEIERRIAKAA 119 Query: 121 ATLGLTEFLERKPKALSGGQRQRVAMGRAIVRNPQVFLMDEPLSNLDAKLRVQTRTQIAA 180 +L + FL+RKP+ LSGGQRQRVAMGRAIVR P FL DEPLSNLDAKLRVQ R +I Sbjct: 120 KSLEIEPFLDRKPRQLSGGQRQRVAMGRAIVREPAAFLFDEPLSNLDAKLRVQMRVEIKR 179 Query: 181 LQRKLGVTTVYVTHDQTEALTMGDRIAVLKDGYLQQVGAPRELYDRPANVFVAGFIGSPA 240 LQR LG T+VYVTHDQ EA+T+ DR+ VL G ++QVG P ELY+ PA FVA FIGSP+ Sbjct: 180 LQRALGTTSVYVTHDQLEAMTLADRLVVLNGGRIEQVGTPIELYENPATAFVATFIGSPS 239 Query: 241 MNLGTFSVKDGDATSGHARIKLSPETLAAMTPEDNGRITIGFRPEALEIIPEGESTD-LS 299 MNL D +G+A +P L G TIG RPE + + + + + Sbjct: 240 MNL-------LDLNTGNAAWS-APAALVGKP----GLATIGIRPEDITLAGDTDGGERFR 287 Query: 300 IPIKLDFVEELGSDSFLYGKL 320 +++ VE +G++S+++G L Sbjct: 288 ARVRVGAVELVGAESYVHGTL 308 Lambda K H 0.316 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 396 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 349 Length adjustment: 29 Effective length of query: 347 Effective length of database: 320 Effective search space: 111040 Effective search space used: 111040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory