Align Mannitol dehydrogenase DSF1; Deletion suppressor of MPT5 mutation protein 1; EC 1.1.1.67 (characterized)
to candidate SM_b20749 SM_b20749 D-mannonate oxidoreductase
Query= SwissProt::P0CX08 (502 letters) >FitnessBrowser__Smeli:SM_b20749 Length = 487 Score = 363 bits (933), Expect = e-105 Identities = 198/489 (40%), Positives = 292/489 (59%), Gaps = 12/489 (2%) Query: 12 LNAKTLKSFESTLPIPTYPREGVKQGIVHLGVGAFHRSHLAVFMHRLMQEHHLKDWSICG 71 L+ KT+ T+ P Y V GIVHLG+GAFHR+H AV+ L+ E W ICG Sbjct: 3 LSRKTIDRLPRTVKRPHYDLGTVTVGIVHLGIGAFHRAHQAVYTDGLLSED--PSWGICG 60 Query: 72 VGLMKADALMRDAMKAQDCLYTLVERGIKDTNAYIVGSITAYMYAPDDPRAVIEKMANPD 131 V L + RDA+ QD LYTL + + + +VGS+ + APDDP AV+ +MA+P Sbjct: 61 VSLRSPET--RDALHPQDGLYTLAVQDGEGSELSVVGSVVELLCAPDDPEAVLRRMADPG 118 Query: 132 THIVSLTVTENGYYHSEATNSLMTDAPEIINDLNHPEKPDTLYGYLYEALLLRYKRGLTP 191 T IVSLT+TE GY H+ AT +L P+I++DL +P +P + G++ EA+ R G+ P Sbjct: 119 TRIVSLTITEKGYCHNPATGTLDEGHPDIVHDLANPARPRSAIGFIVEAISRRVSAGIAP 178 Query: 192 FTIMSCDNMPQNGVTVKTMLVAFAKLKKDEKFAAWIEDKVTSPNSMVDRVTPRCTDKERK 251 FT++SCDN+P NG +K ++ FA+ + D AA + + V SP++MVDR+ P TD +R Sbjct: 179 FTLLSCDNLPGNGHVLKRIVTQFAEAR-DPALAAVVRN-VASPSTMVDRIVPATTDSDRS 236 Query: 252 YVADTWGIKDQCPVVAEPFIQWVLEDNFSDGRPPWELVGVQVVKDVDSYELMKLRLLNGG 311 VA G++D P++ EPF QWV+E++F GRP WE G V+DV ++E MKLRLLNG Sbjct: 237 AVASAMGLEDAWPIMTEPFRQWVIEEDFPLGRPAWEKAGALFVQDVSAFEFMKLRLLNGS 296 Query: 312 HSAMGYLGYLAGYTYIHEVVNDPTINKYIRVLMREEVIPLLPKVPGVDFEEYTASVLERF 371 HS + YLGYLAG + + + + + LMR EV P LP++PG D Y A +L+RF Sbjct: 297 HSTLAYLGYLAGAETVADAMALAGMEALVEGLMRHEVSPTLPELPGFDLPAYRAELLQRF 356 Query: 372 SNPAIQDTVARICLMGSGKMPKYVLPSIYEQLRKPDGKYKLLAVCVAGWFRYLTGVDMNG 431 NPA++ +I + GS K+P+ +L SI ++L+ G Y LA+ VA W RY G+D G Sbjct: 357 RNPALRHRTWQIAMDGSQKLPQRLLGSIRDRLQAGAG-YDRLALGVAAWMRYARGLDEAG 415 Query: 432 KPFEIEDPMAPTLKAAAVKGGKDPHEL----LNIEVLFSPEIRDNKEFVAQLTHSLETVY 487 +P ++ DP A + A +G +P + L + +F ++ + F A L +L+ + Sbjct: 416 RPIDVRDPHAARI-AGLARGIDEPDRIVDAFLTMTDVFGTDLPASAPFRAALIKALDGLL 474 Query: 488 DKGPIAAIK 496 G A ++ Sbjct: 475 RIGAAATLR 483 Lambda K H 0.319 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 656 Number of extensions: 36 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 502 Length of database: 487 Length adjustment: 34 Effective length of query: 468 Effective length of database: 453 Effective search space: 212004 Effective search space used: 212004 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory