Align mannitol 2-dehydrogenase (EC 1.1.1.67) (characterized)
to candidate SMc01214 SMc01214 zinc-containing alcohol dehydrogenase
Query= BRENDA::Q6ECH5 (336 letters) >FitnessBrowser__Smeli:SMc01214 Length = 347 Score = 190 bits (482), Expect = 5e-53 Identities = 103/328 (31%), Positives = 166/328 (50%), Gaps = 13/328 (3%) Query: 1 MEALVLTGKKQLEIEDIKEPEIKPDEVLIHTAYAGICGTDKALYAGLPGSASAVPPIVLG 60 M+A+ L + + ++ PE PD++L+ GICGTD+ L L G + PP+ LG Sbjct: 1 MKAVRLESVGNISVRNVGIPEPGPDDLLVKVEACGICGTDRHL---LHGEFPSTPPVTLG 57 Query: 61 HENSGVVTKVGSEVTNVKPGDRVTVDPNIYCGQCKYCRTQRPELCEHLDAVGVTRNGGFE 120 HE G+V + GS V ++ PG R+T DPNI CG+C C+ R LC +L A+G+ R+GGF Sbjct: 58 HEFCGIVVEAGSAVRDIAPGARITGDPNISCGRCPQCQAGRVNLCRNLRAIGIHRDGGFA 117 Query: 121 EYFTAPAKVVYPIPDDVSLKAAAVVEPISCAMHGVDLLETHPYQKALVLGDGFEGQLFAQ 180 EY P K + IP + A EP++C +HGVDL +LG G G L Q Sbjct: 118 EYVLVPRKQAFEIPLTLDPVHGAFCEPLACCLHGVDLSGIKAGSTVAILGGGVIGLLTVQ 177 Query: 181 ILKARGIHEVTLAGRSDEKLENNRKHFGVKTIDTTKEEI----------PADAYDIVVEA 230 + + G V L+ R K + T+D + ++ D+V+E Sbjct: 178 LARLAGATTVILSTRQATKRRLAEEVGATATVDPSAGDVVEAIAGPVGLVPGGVDVVIEC 237 Query: 231 VGLPATQEQALAAAARGAQVLMFGVGNPDDKFSVNTYDVFQKQLTIQGAFVNPYTFEDSI 290 G+ T +Q+ A G V++ GV +K + +D+ ++L + G+F+NP+ + Sbjct: 238 AGVAETVKQSTRLAKAGGTVVILGVLPQGEKVEIEPFDILFRELRVLGSFINPFVHRRAA 297 Query: 291 ALLSSGVVDPLPLFSHELDLDGVEDFVS 318 L+++G ++ + S + LD D +S Sbjct: 298 DLVATGAIEIDRMISRRISLDEAPDVIS 325 Lambda K H 0.316 0.136 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 289 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 347 Length adjustment: 29 Effective length of query: 307 Effective length of database: 318 Effective search space: 97626 Effective search space used: 97626 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory