Align NADP-dependent mannitol dehydrogenase; MtDH; Mannitol 2-dehydrogenase [NADP(+)]; Allergen Cla h 8; EC 1.1.1.138 (characterized)
to candidate SMc02034 SMc02034 oxidoreductase
Query= SwissProt::P0C0Y5 (267 letters) >FitnessBrowser__Smeli:SMc02034 Length = 257 Score = 143 bits (361), Expect = 3e-39 Identities = 100/262 (38%), Positives = 133/262 (50%), Gaps = 18/262 (6%) Query: 13 LDQLSLKGKVVVVTGASGPKGMGIEAARGCAEMGAAVAITYASRAQGAEENVKELEKTYG 72 L + L G+V VVTGA +G+G+ A E GAAV +T S A+ E L Sbjct: 3 LRKFDLSGRVAVVTGAG--QGIGLACAEALCEAGAAVVLTDIS-AERCEAGRAALA---- 55 Query: 73 IKAKAYKCQVDSYESCEKLVKDVVADFGQI-----DAFIANAG-ATADSGILDGSVEAWN 126 AK Y + D + + + VAD + D +ANAG A A + S W Sbjct: 56 --AKGYVVETDLIDIGDSASVNAVADRLAVSGRAADILVANAGIAHAGVPAEELSDADWE 113 Query: 127 HVVQVDLNGTFHCAKAVGHHFKERGTGSLVITASMSGHIANFPQEQTSYNVAKAGCIHMA 186 ++ ++L+G F +A G H +G GS+V SMSG I N PQ+Q YN AKAG H+ Sbjct: 114 RMIGINLSGAFRSCRAFGRHMLAKGRGSIVTIGSMSGTIVNRPQQQVHYNAAKAGVHHLT 173 Query: 187 RSLANEW-RDFARVNSISPGYIDTGLSDFV--PKETQQLWHSMIPMGRDGLAKELKGAYV 243 RSLA EW RVNS++P YIDT L F K + W M PM R G E+ + Sbjct: 174 RSLAAEWAARGVRVNSVAPTYIDTPLLTFAKEDKPMYEQWLDMTPMHRLGQPDEIASVVL 233 Query: 244 YFASDASTYTTGADLLIDGGYT 265 + ASDAS+ TG+ + D GYT Sbjct: 234 FLASDASSLMTGSIVAADAGYT 255 Lambda K H 0.316 0.131 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 257 Length adjustment: 25 Effective length of query: 242 Effective length of database: 232 Effective search space: 56144 Effective search space used: 56144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory