Align MtlG, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized)
to candidate SM_b21105 SM_b21105 sugar ABC transporter permease
Query= TCDB::O30493 (276 letters) >FitnessBrowser__Smeli:SM_b21105 Length = 288 Score = 152 bits (384), Expect = 8e-42 Identities = 87/287 (30%), Positives = 153/287 (53%), Gaps = 11/287 (3%) Query: 1 MTLQQSRRLQSLLLGTLAWA----IAILIFFPIFWMVLTSFKTEIDAFATPPQFI-FTPT 55 M S RL+ LL A ++I P W+VL+S + ++ A PP +I T + Sbjct: 1 MDTNASHRLRRRLLKVAHLAGLFLAMLVICLPGLWIVLSSLRPTVEIMAKPPVWIPETLS 60 Query: 56 LENYLHINERSNY-----FSYAWNSVLISFSATALCLLISVPAAYSMAFYETKRTKSTLL 110 L+ Y + + + Y NS+++S ++T + L I + Y+ A Y K + L Sbjct: 61 LDAYRAMFSGAGQGGVPVWDYFRNSLIVSVTSTVIALAIGLSGGYAFARYRFKAKSAIFL 120 Query: 111 WMLSTKMLPPVGVLMPIYLLAKSFGLLDTRIALIIIYTLINLPIVVWMVYTYFKDIPKDI 170 + T+ +P + + +P+++L G++DT +LI+ Y +N+P +W++ +F+ +PKD+ Sbjct: 121 GFMLTRAVPGIALSLPLFMLYARTGIIDTHFSLILTYVALNVPFTIWLIDGFFRQVPKDL 180 Query: 171 LEAARLDGATLWQEMVRVLLPIAKGGLASTVLLSLILCWNEAFWSLNLTSS-NAAPLTAL 229 EAA++DG T WQ +V P+A G+AS + + + WNE + +T S N+ L Sbjct: 181 AEAAQIDGCTPWQAFWQVEFPLAGPGIASAGIFAFLTSWNEYALASQITRSVNSKTLPVG 240 Query: 230 IASYSSPEGLFWAKLSAVSTLACAPILIFGWISQKQLVRGLSFGAVK 276 + Y++ + W + A++ + P L +I QK LV GL+FGAVK Sbjct: 241 LLDYTAEFTIDWRGMCALAVVMIVPALTLTFIIQKHLVSGLTFGAVK 287 Lambda K H 0.327 0.137 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 288 Length adjustment: 26 Effective length of query: 250 Effective length of database: 262 Effective search space: 65500 Effective search space used: 65500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory