Align ABC transporter for D-mannitol and D-mannose, permease component 2 (characterized)
to candidate SMc01626 SMc01626 ABC transporter permease
Query= reanno::pseudo3_N2E3:AO353_25890 (276 letters) >FitnessBrowser__Smeli:SMc01626 Length = 285 Score = 168 bits (426), Expect = 1e-46 Identities = 95/284 (33%), Positives = 156/284 (54%), Gaps = 10/284 (3%) Query: 3 LQQTRRLQSLLLGTLAWAIAILIFFPIFWMVLTSFKTEIDAFATPPQFIFTPTLENYL-- 60 ++ T ++ LL G + + FPI W+ L SF+T PP +FTPTLENY Sbjct: 1 METTSPVERLLRGVALTLVVVFFMFPIVWIFLMSFQTNETILRIPPSVVFTPTLENYAAL 60 Query: 61 ---HVNERSGYFSFAW-----NSVVISFSATALCLLIAVPAAYSMAFYETQRTKGTLLWM 112 + SG A+ NSV++S ++ AL L++ VPAAY+ A ++ + ++ + Sbjct: 61 ITGKLQTASGTLDIAFMRNLGNSVLLSVASVALALVLGVPAAYAFARHKFRGSEDIAFTL 120 Query: 113 LSTKMLPPVGVLMPIYLLAKSFGLLDTRIALIIIYTLINLPIVVWMIYTYFKDIPKDILE 172 LS + PP+ VL+P+ + GL +T LI IY LI LP+++W++ YF+DI D+ Sbjct: 121 LSFRFAPPLLVLLPLTQYFQWLGLSNTYFGLIWIYQLICLPLILWIVRGYFEDISADVEY 180 Query: 173 AARLDGATLWQEMVRVLLPIAKGGLASTVLLSLILCWNEAFWSLNLTSSKAAPLTALIAS 232 A R+ G + + ++ LP+A G+A+ LL+ I WN ++L L S+ P+T + Sbjct: 181 AYRIAGHSWFSTFRKIALPLAGPGIAAAGLLAFIFAWNNFVFALVLASADKQPVTVGALA 240 Query: 233 YSSPEGLFWAKLSAVSTLACAPILIFGWISQKQLVRGLSFGAVK 276 + + G+ + +++A L+ P L +Q+ LV GLS GAVK Sbjct: 241 FVTASGIQYGQIAAAIVLSITPTLALALYAQRYLVEGLSLGAVK 284 Lambda K H 0.327 0.138 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 285 Length adjustment: 26 Effective length of query: 250 Effective length of database: 259 Effective search space: 64750 Effective search space used: 64750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory