Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate SM_b20352 SM_b20352 sugar ABC transporter permease
Query= uniprot:D8IZC8 (344 letters) >FitnessBrowser__Smeli:SM_b20352 Length = 354 Score = 222 bits (565), Expect = 1e-62 Identities = 120/297 (40%), Positives = 187/297 (62%), Gaps = 17/297 (5%) Query: 59 NFASAENTMNILRQVAINLVLAAGMTFVILTAGIDLSVGSVLAVSAVL-------GMQVS 111 NF S N + + + VA+N LA GMTFVI+T GIDLSVGS++ + ++ G+ + Sbjct: 44 NFLSTANLILMSKHVALNAFLAMGMTFVIITGGIDLSVGSIVGLCGMVAGGLILNGIDLQ 103 Query: 112 LGAAPGWAIP----MFIFSGLVMGMVNGAMVALLNINAFVVTLGTMTAFRGAAYLLADGT 167 G + + + + G+V+G VNG ++ LN+ F+ TLGT+ RG A L + G Sbjct: 104 FGYTVYFNVVEVCLITLAVGIVIGAVNGLLITKLNVAPFIATLGTLYVARGFALLSSGGQ 163 Query: 168 TVLNN------DIPSFEWIGNGDFLHVPWLIWVAVAVVLLSWVILRKTVLGMHIYAIGGN 221 T N F ++G+G L +P IWV + V L + + R T +G HI+A+GGN Sbjct: 164 TFPNLVGKPELATTGFAFLGSGRLLGLPVSIWVLIVVALAAAYVARYTPIGRHIFAVGGN 223 Query: 222 LQAARLTGIRVGLVLLFVYSISGLFSGLAGAMSASRLYGANGNWGSGYELDAIAAVVLGG 281 +AAR++GIRV V +FVY SG + + G + +S L ++ G+ +EL+AIAA VLGG Sbjct: 224 ERAARMSGIRVDRVKMFVYMFSGFCAAIVGLVISSELMASHPATGNSFELNAIAAAVLGG 283 Query: 282 TSLMGGVGSIWGTVVGALIIGVMNNGLTILGLSSFWQYVAKGAVIVLAVILDKWRQK 338 TS+ GG G+I GT++GA +IG++++GL ++G+SSFWQ V KG VI++AV++D+ +++ Sbjct: 284 TSMSGGRGTIGGTIIGAFVIGILSDGLVMMGISSFWQMVIKGIVIIVAVVVDQAQRR 340 Lambda K H 0.324 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 339 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 354 Length adjustment: 29 Effective length of query: 315 Effective length of database: 325 Effective search space: 102375 Effective search space used: 102375 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory