Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate SM_b21375 SM_b21375 sugar uptake ABC transporter permease
Query= uniprot:D8IZC8 (344 letters) >FitnessBrowser__Smeli:SM_b21375 Length = 320 Score = 226 bits (576), Expect = 6e-64 Identities = 125/279 (44%), Positives = 183/279 (65%), Gaps = 10/279 (3%) Query: 60 FASAENTMNILRQVAINLVLAAGMTFVILTAGIDLSVGSVLAVSAVLGMQV---SLGAAP 116 F + N MNIL+QVA+ + A GMT+VIL IDLSVGS++AV+ ++G Q +G AP Sbjct: 39 FMTVVNFMNILQQVAVVAIAAFGMTWVILLGEIDLSVGSIIAVAGMVGAQCFAFGMGFAP 98 Query: 117 GWAIPMFIFSGLVMGMVNGAMVALLNINAFVVTLGTMTAFRGAAYLLADGTTVLNNDIPS 176 AI + + +G +MGM+NG + A L + +F+VT+ TM +RG L +G + I + Sbjct: 99 --AIALTLAAGALMGMLNGVLTAKLLLPSFIVTVATMGIYRGMVSLPTNGAPAM---IEN 153 Query: 177 FEW--IGNGDFLHVPWLIWVAVAVVLLSWVILRKTVLGMHIYAIGGNLQAARLTGIRVGL 234 W IG FL +P +IWV + +++ ++L KT G Y GGN +AA +GI+V Sbjct: 154 ETWTAIGTESFLGLPIIIWVVAVLFVINQIVLSKTSFGRRAYLTGGNREAAVYSGIKVDR 213 Query: 235 VLLFVYSISGLFSGLAGAMSASRLYGANGNWGSGYELDAIAAVVLGGTSLMGGVGSIWGT 294 + + ++ ISG+ + ++G + +SRL+ A N G YELDAIAA VLGGTSL GGVG++ GT Sbjct: 214 LKILIFMISGVMAAISGVLLSSRLFSAQTNAGMSYELDAIAAAVLGGTSLAGGVGTMVGT 273 Query: 295 VVGALIIGVMNNGLTILGLSSFWQYVAKGAVIVLAVILD 333 ++GALIIGVMNNG+ +L + F+Q + KG VI++AV LD Sbjct: 274 LIGALIIGVMNNGMNMLSVPYFYQLIVKGLVILVAVWLD 312 Lambda K H 0.324 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 311 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 320 Length adjustment: 28 Effective length of query: 316 Effective length of database: 292 Effective search space: 92272 Effective search space used: 92272 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory