Align TM1748, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate SMc04295 SMc04295 peptide transport system permease ABC transporter protein
Query= TCDB::Q9X270 (289 letters) >FitnessBrowser__Smeli:SMc04295 Length = 298 Score = 184 bits (466), Expect = 3e-51 Identities = 92/294 (31%), Positives = 158/294 (53%), Gaps = 19/294 (6%) Query: 3 RKNKTESIGYWKAFWLRFKKNKMAVIGGVFVLILIALAILAPYIAPYPYDEPHYIRAFEG 62 ++N+T + W R +A+IG +++++ A LAP++ PY +PH + FEG Sbjct: 12 KENRTPGV------WTRLLHRPLALIGLAVIIVVVGAAALAPWVVPY---DPHE-QFFEG 61 Query: 63 ---------PSKDFIFGTDALGRDLFSRILYSLRNACIIGFGSQFVVLIIGGILGAVAGF 113 P+ F GTD +GRDL SR++Y R + +IG + + ++IG ++G AG+ Sbjct: 62 LTIEGAPLPPNSQFWLGTDLVGRDLLSRLIYGARTSLVIGVVANGIAVVIGSLVGIAAGY 121 Query: 114 KGGWIDKFIMSIVDIMFAFPTFLFNVILVTALGRGLFTIFLAIGLTGWAGMARLVRGQVL 173 GW+D +M D+M AFP L ++L L+ + + I + W +AR+V + Sbjct: 122 FRGWVDTVLMRFTDLMMAFPALLLAIVLAAIFTPSLWIVAMVIAMVNWVQIARVVYTETR 181 Query: 174 YLKNSEFVEAAKAAGASTFYIIRKHILPNMIGPILVNLAFGVPGAMMTESGLAVIGMGVR 233 + +FV A +A GA I+ +HILP+++ I+V G+ ++ E+ L+ +G+GV+ Sbjct: 182 SIAERDFVTAERAMGAGAGRILFRHILPHLLSTIIVWATLGIATTVLLEATLSFLGIGVQ 241 Query: 234 PPMPSWGNLIGEGIGMMMAFPHLLIFPAVTFAFTLISFTFLADGLRDAFNPRSE 287 PP+PSWGN+I E + P L+ P ++F + D LRD +P + Sbjct: 242 PPIPSWGNIIFENQTYFTSAPWLVFIPGAAILALALAFNLVGDALRDVLDPTQQ 295 Lambda K H 0.331 0.147 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 254 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 298 Length adjustment: 26 Effective length of query: 263 Effective length of database: 272 Effective search space: 71536 Effective search space used: 71536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory