Align TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate SMa2081 SMa2081 ABC transporter ATP-binding protein
Query= TCDB::Q9X271 (324 letters) >FitnessBrowser__Smeli:SMa2081 Length = 332 Score = 286 bits (732), Expect = 5e-82 Identities = 155/321 (48%), Positives = 214/321 (66%), Gaps = 11/321 (3%) Query: 1 MMELLNVNNLKVEFHRVEGIVKAVDGISYKLNKGESLGIVGESGSGKSVSVLSLLRLINR 60 M LL V+NL + F R E V +S+++ GE+L IVGESGSGKS++ L+L++L+ R Sbjct: 1 MAPLLQVDNLTIGFPRAE----PVRNLSFEVGAGETLAIVGESGSGKSLTALALMQLLPR 56 Query: 61 NGRIVDGEAIFLGKDLLKLNKEELRNIRGKDISIIFQNPMTSLNPIIRVGIQVMEPIIWH 120 ++ G IF +DLL L+ E+R +RG++I++IFQ PMTSLNP++ +G Q+ E + H Sbjct: 57 AAQVTSGRIIFDDRDLLDLDAREMRRLRGREIAMIFQEPMTSLNPVMSIGRQIGEVLKVH 116 Query: 121 RLMKNEEARERAIELLERVGIPESPKRFLNYPFQFSGGMRQRVMIAMALACHPKLLIADE 180 ARERAIELL+ V IP + KR +YP Q SGGMRQRVMIAMA+AC PKLLIADE Sbjct: 117 EKASARAARERAIELLKLVRIPAAEKRIDDYPHQLSGGMRQRVMIAMAVACRPKLLIADE 176 Query: 181 PTTALDVTIQAQIMELLQELKEEYGMSVIFITHDLSVATNFCDRIITMYAGKIVEEAPVE 240 PTTALDVTIQAQ+++LL L+ E M+V+ ITHDL V + D+++ MYAG+ VE+A Sbjct: 177 PTTALDVTIQAQVLDLLDTLRRELQMAVVLITHDLGVVAQWADKVVVMYAGRKVEQALPG 236 Query: 241 EILKTPLHPYTKGLLNSTLEIGS-----RGKKLVPIPGNPPNPTKHPSGCKFHPRCSFAM 295 ++ PLHPYT+GLL+++ + + RG L IPG+ + +GC F PRC A Sbjct: 237 DLFNDPLHPYTRGLLSASPRLKADFHYLRG-PLNEIPGSIVSAAGE-AGCPFRPRCDQAR 294 Query: 296 EICQREEPPLVNISENHRVAC 316 C + PPL+ + + VAC Sbjct: 295 ASCALQVPPLIAQTPDRLVAC 315 Lambda K H 0.320 0.139 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 274 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 332 Length adjustment: 28 Effective length of query: 296 Effective length of database: 304 Effective search space: 89984 Effective search space used: 89984 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory