Align TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate SMc03126 SMc03126 transport system ATP-binding ABC transporter protein
Query= TCDB::Q9X272 (328 letters) >FitnessBrowser__Smeli:SMc03126 Length = 332 Score = 269 bits (687), Expect = 8e-77 Identities = 140/294 (47%), Positives = 192/294 (65%), Gaps = 2/294 (0%) Query: 30 LKAVDGISIEIKEGETLGLVGESGCGKSTLGRTILKLLRPDGGKIFFEGKDITNLNDKEM 89 ++AVDGIS+ + GETLG+VGESG GKSTLGR +L L G++ FEG + Sbjct: 27 VRAVDGISLAVMPGETLGIVGESGSGKSTLGRMLLGLDPAQAGEVRFEGSPVPKYGTAGW 86 Query: 90 KPYRKKMQIIFQDPLGSLNPQMTVGRIIEDPLIIHKIGTKKERRKRVEELLDMVGIGREF 149 + R KMQ+++QDPL +L+ ++T+ I +PL IH++ K+ + R+ EL+ VG+ + Sbjct: 87 RALRAKMQLVYQDPLAALDRRLTLAAQIGEPLDIHRLVPKEHQAARIAELMAAVGLRSDQ 146 Query: 150 INSFPHEFSGGQQQRIGIARALALNPKFIVCDEPVSALDVSIQAQIIDLLEEIQQKMGIS 209 FPHE SGGQ+QR IARALA PK +VCDEPVSALDVSIQAQ++++L ++Q+K GI+ Sbjct: 147 AGRFPHELSGGQRQRAVIARALASRPKLLVCDEPVSALDVSIQAQVVNMLRDLQEKNGIA 206 Query: 210 YLFIAHNLAVVEHISHKVAVMYLGKIVEYGDVDKIFLNPIHPYTRALLKSVPKIPWDGQK 269 +FI+H+L VV +I+ +VAVMYLG+IVE D IF P HPYT+AL+ SVP +P + Sbjct: 207 MIFISHDLKVVRNIADRVAVMYLGRIVEEASSDVIFRAPQHPYTKALVSSVP-VPGKPLE 265 Query: 270 QRFYSLKGELPSPIDLPKGCRFQTRCTEKKAICFEKEPELTEVEKNHFVSCHLV 323 R L+GE P+P D P GC F RC + IC P L +CH V Sbjct: 266 GRVI-LQGEPPNPADRPSGCAFHPRCPVARDICRTSVPALRRTGNGRTAACHAV 318 Lambda K H 0.321 0.142 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 318 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 332 Length adjustment: 28 Effective length of query: 300 Effective length of database: 304 Effective search space: 91200 Effective search space used: 91200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory