Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate SM_b20419 SM_b20419 glycerol-3-phosphate ABC transporter ATP-binding protein
Query= BRENDA::Q97UY8 (353 letters) >FitnessBrowser__Smeli:SM_b20419 Length = 349 Score = 214 bits (545), Expect = 3e-60 Identities = 126/308 (40%), Positives = 190/308 (61%), Gaps = 12/308 (3%) Query: 1 MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTG 60 M I +K+V K + G + A+ V++ I +GE ++GPSG GK+T +R+IAGL+ ++G Sbjct: 1 MATITLKDVHKTYH-GDIAAIRGVSLAIADGEFIVLVGPSGCGKSTLLRMIAGLESITSG 59 Query: 61 ELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKR 120 E+ DR+V NG + P +R I MVFQ +ALYP++T +N+++ L N KEEI +R Sbjct: 60 EISIGDRVV--NG---LEPSERDIAMVFQNYALYPHMTVRQNLSYGLKNRNTPKEEIERR 114 Query: 121 VEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSAR 180 + + AK L+I L+ PR+LSGGQ+QRVA+ RA+V++P+ L DEP SNLDA++R R Sbjct: 115 IAKAAKSLEIEPFLDRKPRQLSGGQRQRVAMGRAIVREPAAFLFDEPLSNLDAKLRVQMR 174 Query: 181 ALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASL 240 +K +Q LG T + V+HD + +ADR+ VL G++ QVG P +LY+NP + VA+ Sbjct: 175 VEIKRLQRALGTTSVYVTHDQLEAMTLADRLVVLNGGRIEQVGTPIELYENPATAFVATF 234 Query: 241 IG--EINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSW-ILVG 297 IG +N L+ N G S + A IGIRPED+ L+ D + + V Sbjct: 235 IGSPSMNLLD---LNTGNAAWSAPAALVGKPGLATIGIRPEDITLAGDTDGGERFRARVR 291 Query: 298 KGKVKVIG 305 G V+++G Sbjct: 292 VGAVELVG 299 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 282 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 349 Length adjustment: 29 Effective length of query: 324 Effective length of database: 320 Effective search space: 103680 Effective search space used: 103680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory