Align Inositol transport system ATP-binding protein (characterized)
to candidate SMa0216 SMa0216 ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF717 (261 letters) >FitnessBrowser__Smeli:SMa0216 Length = 246 Score = 184 bits (467), Expect = 2e-51 Identities = 101/242 (41%), Positives = 150/242 (61%), Gaps = 4/242 (1%) Query: 3 MSQP-LIRMQGIEKHFGSVIALAGVSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPTK 61 MS P L+ + I K FG++ AL +S + GE LLGDNGAGKST + +SG+HKPT Sbjct: 2 MSTPNLLELHNISKSFGALTALRNLSFHIGEGEVVGLLGDNGAGKSTTVNLISGIHKPTD 61 Query: 62 GDILFEGQPLHFADPRDAIAAGIATVHQHLAMIPLMSVSRNFFMGNEPIRKIGPLKLFD- 120 G + +G+ F+ D+ AGI T++QH A++ +S++RN FMG E + G L+ + Sbjct: 62 GYLSVDGKKTTFSCRSDSADAGIETIYQHTALVDSLSITRNIFMGRELTDRFGFLRQREM 121 Query: 121 HDYANRITMEEMRKMGINLRGPDQAVGTLSGGERQTVAIARAVHFGAKVLILDEPTSALG 180 D A + + GI+ PD VG LSGG++Q VAIARAV+F +VL+LDEPTSAL Sbjct: 122 RDIAMEVLQNAVHISGID--SPDTLVGNLSGGQKQAVAIARAVYFKKRVLLLDEPTSALS 179 Query: 181 VRQTANVLATIDKVRKQGVAVVFITHNVRHALAVGDRFTVLNRGKTLGTAQRGDISAEEL 240 VR+T +L + K++ + V+ V +THN+ HA V DRF +++ G + Q+ D + +L Sbjct: 180 VRETEALLNQVLKLKAENVSSVLVTHNLYHAYQVCDRFVIMSHGTKVFDVQKADTTISQL 239 Query: 241 QD 242 + Sbjct: 240 TE 241 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 246 Length adjustment: 24 Effective length of query: 237 Effective length of database: 222 Effective search space: 52614 Effective search space used: 52614 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory