Align Inositol transport system ATP-binding protein (characterized)
to candidate SMc03815 SMc03815 ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF717 (261 letters) >FitnessBrowser__Smeli:SMc03815 Length = 259 Score = 182 bits (463), Expect = 5e-51 Identities = 97/245 (39%), Positives = 152/245 (62%), Gaps = 1/245 (0%) Query: 7 LIRMQGIEKHFGSVIALAGVSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPTKGDILF 66 L R++ I K FG+V AL GV++++ GE L+GDNGAGKST +KT++G +P+ G + Sbjct: 16 LARLENIVKDFGAVRALDGVTLEINQGEILGLMGDNGAGKSTLVKTIAGNFQPSSGSYIL 75 Query: 67 EGQPLHFADPRDAIAAGIATVHQHLAMIPLMSVSRNFFMGNEPIRKIGPLKLFDHDYANR 126 EG+P+ F+ P +A GI V+Q LA+ ++ S N F+G E +R++GP K+ DH N Sbjct: 76 EGKPVVFSGPAEARRHGIEVVYQDLAICDNLTASANVFLGRELMRQVGPFKVLDHKRMNA 135 Query: 127 ITMEEMRKMGINLRGPDQAVGTLSGGERQTVAIARAVHFGAKVLILDEPTSALGVRQTAN 186 + E +++ R P V +SGG+RQ VAIAR +K++++DEPT+A+ VRQ A Sbjct: 136 RSAEIFKELKSETR-PADLVVRMSGGQRQAVAIARTRLARSKIVLMDEPTAAISVRQVAE 194 Query: 187 VLATIDKVRKQGVAVVFITHNVRHALAVGDRFTVLNRGKTLGTAQRGDISAEELQDMMAG 246 VLA I +++ QG++V+ I+H + V DR V+ RG+ + G S EE+ ++ G Sbjct: 195 VLALIRRMKAQGLSVILISHRMPDVFEVCDRVVVMRRGRKVADKMIGQSSPEEVTGLITG 254 Query: 247 GQELA 251 + A Sbjct: 255 AIQTA 259 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 159 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 259 Length adjustment: 24 Effective length of query: 237 Effective length of database: 235 Effective search space: 55695 Effective search space used: 55695 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory