Align Rhizopine-binding protein (characterized, see rationale)
to candidate SM_b20072 SM_b20072 rhizopine binding protein
Query= uniprot:A0A0N9WNI6 (308 letters) >FitnessBrowser__Smeli:SM_b20072 Length = 309 Score = 244 bits (624), Expect = 1e-69 Identities = 124/300 (41%), Positives = 200/300 (66%), Gaps = 5/300 (1%) Query: 11 ALSLMLASGAALADLRIGVSMSQFDDTWLTYLRESMDKQAKSMPDGVKLQFEDARSDVVK 70 A L L +G+A A+ +G+++++ D +LT LR M QA + DGV +Q EDA++D + Sbjct: 7 AAVLALFAGSAHAE-NVGITIARSDSAFLTILRNGMQDQAAKL-DGVTVQVEDAQNDTSR 64 Query: 71 QLSQVESFISQKVDAIVVNPVDTAATRKITEAAVKAGIPLVYVNRRPDDL-KLPKGVITV 129 QL QV++F+S VDAI+V VD +T +T+ A AGIP+VY N P D+ KLP+ V Sbjct: 65 QLDQVQNFVSSGVDAIIVVAVDGDSTPALTKMATDAGIPIVYANHPPADVDKLPETAAFV 124 Query: 130 ASNDLEAGQMQMQYLAEKMKGKGDIVILLGDLANNSTTNRTKGVKEVLA--KYPGIKIDQ 187 SN++++G ++ + + + GKG +L+G L N+S+ RTK + +V+A + G+ + + Sbjct: 125 GSNEIDSGTLETKEVCRLLGGKGAAYVLMGPLNNHSSLTRTKDIHDVIATDECKGMSVIE 184 Query: 188 EQTGTWSRDKGMTLVNDWLTQGRKFDAIVSNNDEMAIGAAMALKQAGVEKGSVLIAGVDG 247 EQ+ W R + ++ +WL+ GR+F+AI++NNDEMAIGA A+K AGV+ V++ G+D Sbjct: 185 EQSANWDRLEAANIMTNWLSTGREFNAIIANNDEMAIGAIQAMKAAGVDMSKVVVGGIDA 244 Query: 248 TPDGLRAVKKGDLAVSVFQDANGQAVDSIDAAVKMAKNEPVEQAVWVPYRLITPENVDQF 307 TPDGL A+ GDL V+VFQ+A Q ++DAAV +++++ + +WVP+ L+TPEN+ + Sbjct: 245 TPDGLAAMAAGDLDVTVFQNAIAQGAAAMDAAVALSRDQKTARQIWVPFELVTPENMKDY 304 Lambda K H 0.315 0.130 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 245 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 309 Length adjustment: 27 Effective length of query: 281 Effective length of database: 282 Effective search space: 79242 Effective search space used: 79242 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory