Align Inositol transport system permease protein (characterized)
to candidate SM_b21375 SM_b21375 sugar uptake ABC transporter permease
Query= reanno::WCS417:GFF2333 (340 letters) >FitnessBrowser__Smeli:SM_b21375 Length = 320 Score = 203 bits (516), Expect = 5e-57 Identities = 126/311 (40%), Positives = 186/311 (59%), Gaps = 25/311 (8%) Query: 26 IFLVLIGIGLVFELFGWIVRDQSFLMNSQRLVLMILQVSIIGLLAIGVTQVIITTGIDLS 85 IFL L+ + +VF F M + ++ QV+++ + A G+T VI+ IDLS Sbjct: 21 IFLSLVMLCIVFSFFN------PRFMTVVNFMNILQQVAVVAIAAFGMTWVILLGEIDLS 74 Query: 86 SGSVLALSAMIAASLAQTSDFSRAVFPSLTDLPVWIPVAMGLGVGLLAGAINGSIIAVTG 145 GS++A++ M+ A Q F P+ +A+ L G L G +NG + A Sbjct: 75 VGSIIAVAGMVGA---QCFAFGMGFAPA---------IALTLAAGALMGMLNGVLTAKLL 122 Query: 146 IPPFIATLGMMVSARGLARYYTEGQPVSMLSDSYTAIGHGA---MPVIIFLVVAVIF--- 199 +P FI T+ M RG+ T G P + ++++TAIG + +P+II+ VVAV+F Sbjct: 123 LPSFIVTVATMGIYRGMVSLPTNGAPAMIENETWTAIGTESFLGLPIIIW-VVAVLFVIN 181 Query: 200 HIALRYTKYGKYTYAIGGNMQAARTSGINVKRHLIIVYSIAGLLAGLAGVVASARAATGQ 259 I L T +G+ Y GGN +AA SGI V R I+++ I+G++A ++GV+ S+R + Q Sbjct: 182 QIVLSKTSFGRRAYLTGGNREAAVYSGIKVDRLKILIFMISGVMAAISGVLLSSRLFSAQ 241 Query: 260 AGMGMSYELDAIAAAVIGGTSLAGGVGRITGTVIGALILGVMASGFTFVGVDAYIQDIIK 319 GMSYELDAIAAAV+GGTSLAGGVG + GT+IGALI+GVM +G + V + Q I+K Sbjct: 242 TNAGMSYELDAIAAAVLGGTSLAGGVGTMVGTLIGALIIGVMNNGMNMLSVPYFYQLIVK 301 Query: 320 GLIIVVAVVID 330 GL+I+VAV +D Sbjct: 302 GLVILVAVWLD 312 Lambda K H 0.325 0.140 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 270 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 340 Length of database: 320 Length adjustment: 28 Effective length of query: 312 Effective length of database: 292 Effective search space: 91104 Effective search space used: 91104 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory