Align Inositol 2-dehydrogenase; EC 1.1.1.18; Myo-inositol 2-dehydrogenase; MI 2-dehydrogenase (uncharacterized)
to candidate SMc01163 SMc01163 oxidoreductase
Query= curated2:C5BYN4 (360 letters) >FitnessBrowser__Smeli:SMc01163 Length = 376 Score = 69.7 bits (169), Expect = 1e-16 Identities = 59/199 (29%), Positives = 88/199 (44%), Gaps = 22/199 (11%) Query: 5 IGVVGPGGMGRAHIDRITGELAGGA--------VVAVHDIDEVNARRVAEPIG-AKVFGS 55 IG++G G MG+AH T +A +V+V D+ + A +G K Sbjct: 9 IGLIGTGFMGKAHALGFT--IAARVFDLPFELDLVSVADVTQEGAEAARGRLGFRKATAD 66 Query: 56 ATELVASDAVDAVLVASDGTAHLEPVLAAVAAGKPVLCEKPLAPTAAECEQVMAAEVAAG 115 EL+ +D + + + H E LAA A GK V CEKPLAPT A+C +++AA AG Sbjct: 67 WRELLTDPEIDIIDITTPNLLHKEMALAAFAHGKHVYCEKPLAPTVADCAEMVAAAEKAG 126 Query: 116 RRLVTIGFMRRFDASYLAMKAVLDGGELGEALLVHCRH-----RNPSAREAYRATM---- 166 + +GF + +++ GE+GE H + S +R Sbjct: 127 -VVTQVGFNYLKNPLIFLASDIIESGEIGEIRSFRGIHAEDFMADESVPWGWRLDPRSGG 185 Query: 167 -AITDTAIHEIDAMRWLLG 184 A+ D H I MR L+G Sbjct: 186 GALADIGSHMIACMRHLVG 204 Lambda K H 0.319 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 289 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 376 Length adjustment: 30 Effective length of query: 330 Effective length of database: 346 Effective search space: 114180 Effective search space used: 114180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory