Align mannonate dehydratase (EC 4.2.1.8) (characterized)
to candidate SM_b20446 SM_b20446 mannonate dehydratase
Query= BRENDA::P24215 (394 letters) >FitnessBrowser__Smeli:SM_b20446 Length = 402 Score = 436 bits (1121), Expect = e-127 Identities = 211/395 (53%), Positives = 276/395 (69%), Gaps = 3/395 (0%) Query: 1 MEQTWRWYGPNDPVSLADVRQAGATGVVTALHHIPNGEVWSVEEILKRKAIIEDAGLVWS 60 M TWRW+GP D VS+ D QAGA G+V+ALHHIP G+VW V+EI KR+ + GL W Sbjct: 1 MRHTWRWFGPVDRVSVQDAAQAGAHGIVSALHHIPTGDVWPVDEIGKRQEEVRAGGLEWE 60 Query: 61 VVESVPIHEDIKTHTGNYEQWIANYQQTLRNLAQCGIRTVCYNFMPVLDWTRTDLEYVLP 120 VVESVP+ E IKT TG + + +AN+Q+TLR L+ GIRTVCYNFMPVLDWTRTDL + Sbjct: 61 VVESVPVSECIKTQTGPWREHVANWQETLRRLSAAGIRTVCYNFMPVLDWTRTDLRWTAR 120 Query: 121 DGSKALRFDQIEFAAFEMHILKRPGAEADYTEEEIAQAAERFATMSDEDKARLTRNIIAG 180 G+KA+RFD+I+FAAF++H+L+RP A DY A RF M++E + L+RNI AG Sbjct: 121 HGAKAMRFDRIDFAAFDIHLLERPAAHEDYDTATREAAERRFREMTEERRLALSRNIGAG 180 Query: 181 LPGAEEGYTLDQFRKHLELYKDIDKAKLRENFAVFLKAIIPVAEEVGVRMAVHPDDPPRP 240 LPG+ +GY+L Q R+HL Y + + KL+ + FL + PVAE G+ + HPDDPP Sbjct: 181 LPGSADGYSLPQLREHLRTYDGVSREKLQRHLVEFLAEVAPVAERTGINICAHPDDPPWA 240 Query: 241 ILGLPRIVSTIEDMQWMVDTVNSMANGFTMCTGSYGVRADNDLVDMIKQFGPRIYFTHLR 300 +LGLPRI+S ED +M+ V+S ANG T+CTGS G A NDL M +QF RI+F HLR Sbjct: 241 LLGLPRILSNAEDYAFMLREVDSPANGVTLCTGSLGALAANDLPAMTRQFASRIHFVHLR 300 Query: 301 STMRED--NPKTFHEAAHLNGDVDMYEVVKAIVEEEHRRKAEGKED-LIPMRPDHGHQML 357 + +RE+ P +F+E HL GD DM V+ +++EE RR+A G+ D IPMRPDHG ++L Sbjct: 301 NVLREEVRTPCSFYEDEHLEGDTDMVAVIAELLQEEQRRRAAGRVDHQIPMRPDHGQEIL 360 Query: 358 DDLKKKTNPGYSAIGRLKGLAEVRGVELAIQRAFF 392 DDL + PGY AIGRLKGLAE+RG+E A+ A + Sbjct: 361 DDLSRGAQPGYPAIGRLKGLAELRGIERALSHATY 395 Lambda K H 0.320 0.136 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 502 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 394 Length of database: 402 Length adjustment: 31 Effective length of query: 363 Effective length of database: 371 Effective search space: 134673 Effective search space used: 134673 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate SM_b20446 SM_b20446 (mannonate dehydratase)
to HMM TIGR00695 (uxuA: mannonate dehydratase (EC 4.2.1.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00695.hmm # target sequence database: /tmp/gapView.19750.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00695 [M=394] Accession: TIGR00695 Description: uxuA: mannonate dehydratase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.9e-154 498.6 0.0 8.2e-154 498.4 0.0 1.0 1 lcl|FitnessBrowser__Smeli:SM_b20446 SM_b20446 mannonate dehydratase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SM_b20446 SM_b20446 mannonate dehydratase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 498.4 0.0 8.2e-154 8.2e-154 1 390 [. 1 393 [. 1 396 [. 0.98 Alignments for each domain: == domain 1 score: 498.4 bits; conditional E-value: 8.2e-154 TIGR00695 1 meqtfrwyGrndpvsledvrqaGakGivtalhhipnGevweveeikkrkeeiedaGlsasvvesvpvheeiklq 74 m t+rw+G+ d vs++d qaGa+Giv alhhip+G+vw v+ei kr+ee++ Gl+++vvesvpv e ik+q lcl|FitnessBrowser__Smeli:SM_b20446 1 MRHTWRWFGPVDRVSVQDAAQAGAHGIVSALHHIPTGDVWPVDEIGKRQEEVRAGGLEWEVVESVPVSECIKTQ 74 789*********************************************************************** PP TIGR00695 75 teeyekyienykqtlrnlaqcGikvvcynfmpvldwtrtdlayeledGskalrfdkikvaalelhilkrpdaek 148 t+ +++++n+++tlr l+ Gi++vcynfmpvldwtrtdl + G+ka+rfd+i++aa+++h+l+rp a + lcl|FitnessBrowser__Smeli:SM_b20446 75 TGPWREHVANWQETLRRLSAAGIRTVCYNFMPVLDWTRTDLRWTARHGAKAMRFDRIDFAAFDIHLLERPAAHE 148 ************************************************************************** PP TIGR00695 149 dyteeelvraveeasdmseedkarltrniiaglpGaeegekldrikelleaykdideeklrenlafflkeilpv 222 dy+ +a ++ +m+ee + l+rni aglpG +g+ l +++e+l +y +++ekl+ +l fl e+ pv lcl|FitnessBrowser__Smeli:SM_b20446 149 DYDTATREAAERRFREMTEERRLALSRNIGAGLPGSADGYSLPQLREHLRTYDGVSREKLQRHLVEFLAEVAPV 222 ************************************************************************** PP TIGR00695 223 aeevGvkmaihpddpprpilGlprivstiedmkklveisdspangitlctGsyGvradndlvelakqfadriyf 296 ae G+++ hpddpp+ +lGlpri+s ed+ + +dspang+tlctGs+G+ a+ndl +++qfa+ri+f lcl|FitnessBrowser__Smeli:SM_b20446 223 AERTGINICAHPDDPPWALLGLPRILSNAEDYAFMLREVDSPANGVTLCTGSLGALAANDLPAMTRQFASRIHF 296 ************************************************************************** PP TIGR00695 297 ahlrsvkree..npktfheaahlekdvdlyevvkavleeehrrkaeGked.lipvrpdhGrqllddlkkktnpG 367 hlr+v ree p +f+e hle+d+d+ v+ +l+ee rr+a G+ d ip+rpdhG+++lddl + ++pG lcl|FitnessBrowser__Smeli:SM_b20446 297 VHLRNVLREEvrTPCSFYEDEHLEGDTDMVAVIAELLQEEQRRRAAGRVDhQIPMRPDHGQEILDDLSRGAQPG 370 ********9844689********************************975279********************* PP TIGR00695 368 ysaigrlkGlaelrGlelalkkv 390 y aigrlkGlaelrG+e al ++ lcl|FitnessBrowser__Smeli:SM_b20446 371 YPAIGRLKGLAELRGIERALSHA 393 *******************9876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (394 nodes) Target sequences: 1 (402 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 12.54 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory