Align phosphoserine aminotransferase monomer (EC 2.6.1.52; EC 2.6.1.1) (characterized)
to candidate SMc00640 SMc00640 phosphoserine aminotransferase
Query= metacyc::MONOMER-15918 (370 letters) >FitnessBrowser__Smeli:SMc00640 Length = 392 Score = 484 bits (1247), Expect = e-141 Identities = 237/379 (62%), Positives = 280/379 (73%), Gaps = 10/379 (2%) Query: 2 KPTRVPKNPCFSSGPCAKHPGYSVEELKDTPFGRSHRSKPGKEKLAEAIKRTRDMLGLPD 61 KP P N FSSGPCAK PG+++E L D P GRSHR+K GK KL +AI TR++L +P Sbjct: 6 KPAMRPANTHFSSGPCAKRPGWTLEALSDAPLGRSHRAKIGKTKLKQAIDLTREILEVPA 65 Query: 62 DYFVGIVPASDTGAFEMCLWSMLGCRGVDVLVWESFSKGWATDITKQLKLKDTRVFEAEY 121 DY +GIVPASDTGA EM LWS+LG RGVD+L WESF GW TD+ KQLKL D R EA+Y Sbjct: 66 DYRIGIVPASDTGAVEMALWSLLGARGVDMLAWESFGAGWVTDVVKQLKLSDVRRLEADY 125 Query: 122 GKLPDLKKVDFKNDVVFVWNGTTSGVKVPNADWIPDDREGVTLCDATSAIFAMDIPYHKL 181 G+LPDL KVDF DVVF WNGTTSGV+VPNAD+IP DR+G+T+CDATSA FA + + KL Sbjct: 126 GELPDLSKVDFDRDVVFTWNGTTSGVRVPNADFIPADRKGLTICDATSAAFAQALDFAKL 185 Query: 182 DVITFSWQKVLGGEGAHGMLILSPRAVQRLESYTPAWPLPKIFRLTKGGKLNKDIFAGST 241 DV+TFSWQKVLGGEGAHG+LILSPRAV+RLE+Y PAWPLPKIFR+TKGGKL + IF G T Sbjct: 186 DVVTFSWQKVLGGEGAHGVLILSPRAVERLETYVPAWPLPKIFRMTKGGKLIEGIFTGET 245 Query: 242 INTPSMLANEDWLATLKWAESVGGLKQLIRRTNENLAVFEAFVAKNNWIHFLAETKEIRS 301 INTPSML ED++ L WA+SVGGL+ L+ R + N V FVA N+WI LA E RS Sbjct: 246 INTPSMLCVEDYIDALLWAKSVGGLEGLMARADANAEVIHRFVAANDWIANLAVKPETRS 305 Query: 302 STSVCFKV----------DLSDEKLKELIKTLEKEKVAYDIGSYRDAPSGLRIWCGATVE 351 +TSVC K+ D K ++ LEKE VA+DIG YRDAPSGLRIW GAT+E Sbjct: 306 NTSVCLKIADNDVSALDADAQAAFAKGVVALLEKEGVAFDIGHYRDAPSGLRIWAGATIE 365 Query: 352 KEDLECLCEWIEWAYNLVK 370 D+E L W+ WA+ K Sbjct: 366 TSDMEALMPWLAWAFETQK 384 Lambda K H 0.319 0.136 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 491 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 392 Length adjustment: 30 Effective length of query: 340 Effective length of database: 362 Effective search space: 123080 Effective search space used: 123080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory