Align Aromatic-amino-acid aminotransferase 1; ARAT-I; AROAT; EC 2.6.1.57 (characterized)
to candidate SMc04323 SMc04323 aminotransferase
Query= SwissProt::H3ZPL1 (417 letters) >FitnessBrowser__Smeli:SMc04323 Length = 408 Score = 317 bits (813), Expect = 3e-91 Identities = 183/409 (44%), Positives = 246/409 (60%), Gaps = 15/409 (3%) Query: 16 LDYEKYFSEKALGMKASEIRELLKLVETSDVISLAGGLPAPETFPVEIIGEITKEVLE-K 74 LD+E F+ ++ MKASEIRELLKL++ D+IS AGG+P PE FP + E E+ Sbjct: 2 LDWESIFATRSSRMKASEIRELLKLLDRPDIISFAGGIPDPELFPNDAFREAYAEIFGGP 61 Query: 75 HAAQALQYGTTKGFTPLRLALAEWMRERYDIPISKVDIMTTSGSQQALDLIGRVFINPGD 134 ALQY ++G+ PLR LA M IP S +I TSGSQQ LD +G++F++P D Sbjct: 62 SVGAALQYSISEGYRPLREWLAGQMAA-LGIPASVDNIFITSGSQQGLDYLGKLFLSPKD 120 Query: 135 IIVVEAPTYLAALQAFKYYEPEFVQIPLDDEGMNVDLLEEKLQELEKEGKKVKIVYTIPT 194 +V PTYL ALQAF YEP + Q L+ G Q + G +VK Y Sbjct: 121 TALVTWPTYLGALQAFNAYEPSYDQ--LNPAGNRTPAAYA--QAAAEAGGRVKFAYLSAD 176 Query: 195 FQNPAGVTMNEKRRKRLLELASQYDFIIVEDNPYGELRYSGEPVKPIKAWD-------EE 247 F NP G T+ R+R+LELA + D I+ED Y LRY GE + PI A + Sbjct: 177 FANPTGETVGRAGRERVLELAEELDIAIIEDAAYQSLRYDGEAIPPILALEIARKGDINS 236 Query: 248 GRVIYLGTFSKILAPGFRIGWIAAEPHFIRKLEIAKQSVDLCTNTFSQVIAWKYVEGGYL 307 R IY G+FSK LAPG R+GWI A IRKL + KQ+ DL ++T +Q+ E G+ Sbjct: 237 TRTIYCGSFSKTLAPGLRVGWICAAEPVIRKLVLMKQAADLHSSTINQMAIATVAERGF- 295 Query: 308 DKHIPKIIEFYKPRRDAMLKALEEFMPDGVKWTKPEGGMFVWATLPEGIDTKLMLEKAVA 367 ++ + KI + Y+ RRDAML ALE++MP GV WTKPEGGMF+W TLP+G D +L K++ Sbjct: 296 EEQVAKIHKAYRQRRDAMLSALEKYMPAGVTWTKPEGGMFIWVTLPKGSDGAELLAKSIQ 355 Query: 368 KG-VAYVPGEAFFAHRDVKNTMRLNFTYVPEEKIREGIKRLAETIKEEM 415 VA+VPG AFFA +NT+RL+F+ + I EGI+RL + ++ E+ Sbjct: 356 TAKVAFVPGRAFFADGSGENTLRLSFSCANDRMIDEGIRRLGDLVRGEV 404 Lambda K H 0.318 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 439 Number of extensions: 24 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 417 Length of database: 408 Length adjustment: 31 Effective length of query: 386 Effective length of database: 377 Effective search space: 145522 Effective search space used: 145522 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory