Align cyclohex-1-ene-1-carbonyl-CoA dehydrogenase (EC 1.3.8.10) (characterized)
to candidate SMc01639 SMc01639 acyl-CoA dehydrogenase
Query= BRENDA::Q39QF5 (380 letters) >FitnessBrowser__Smeli:SMc01639 Length = 386 Score = 194 bits (492), Expect = 5e-54 Identities = 136/386 (35%), Positives = 199/386 (51%), Gaps = 16/386 (4%) Query: 4 LTEEQKLTLDMVRDVATREIAPRALELDEKSLFP-----EYARDLFAKLGLLNPLLPAAY 58 LTEEQ++ +D VR EI P E++ + P E AR +LG P Sbjct: 5 LTEEQQMIVDTVRTFVETEIYPHENEVERTGVVPRELGLEIARKC-KELGFFACNFPEEV 63 Query: 59 GGTEMGVLTLALILEELGRVCASTALLLIAQTDGMLPIIHGGSPELKERYLRRFAGESTL 118 GG + LT L+ ELGR + + G+L + + +ERYL A Sbjct: 64 GGAGLDHLTFTLVERELGRGSMGLTVFF-GRPSGILMACN---EDQRERYLLP-AVRGDK 118 Query: 119 LTALAATEPAAGSDLLAMKTRAVRQGDKYVINGQKCFITNGSVADVIVVYAYTDPEKGSK 178 ALA TEP AGSD+ MK A GD +++NG K FI++ +AD ++V+ T E+ + Sbjct: 119 FDALAMTEPDAGSDVRGMKCFARPDGDDWIVNGTKHFISHADIADFVIVFIATGEEQTPR 178 Query: 179 G----ISAFVVEKGTPGLVYGRNESKMGMRGSINSELFFENMEVPAENIIGAEGTGFANL 234 G I+ F+V++GTPG + + RG N L F++ +P+ I+G GF Sbjct: 179 GPKKKITCFLVDRGTPGFEIREGYNSVSHRGYKNCILTFDDCRLPSAQILGEVHKGFDIA 238 Query: 235 MQTLSTNRVFCAAQAVGIAQGALDIAVRHTQDRVQFGKPIAHLAPVQFMVADMATAVEAS 294 L R+ AA +VG A+ A D A+ + +R QFGKPI+ V F +ADM T ++A+ Sbjct: 239 NDWLYATRLTVAATSVGRARRAFDYALSYAAERKQFGKPISANQGVSFKLADMITEIDAA 298 Query: 295 RLLTRKAAELLDDGDKKAVLYGSMAKTMASDTAMRVTTDAVQVLGGSGYMKENGVERMMR 354 LLT AA LD G S AK A++ RVT +A+Q+ GG G M + + R R Sbjct: 299 DLLTLSAAWRLDQGLPSNREIAS-AKVFATEMLARVTDEAIQIYGGMGLMDDLPLARFWR 357 Query: 355 DAKLTQIYTGTNQITRMVTGRALLFP 380 DA++ +I+ GT++I R + R LL P Sbjct: 358 DARVERIWDGTSEIQRHIISRDLLRP 383 Lambda K H 0.319 0.134 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 335 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 386 Length adjustment: 30 Effective length of query: 350 Effective length of database: 356 Effective search space: 124600 Effective search space used: 124600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory