Align Pterin-4-alpha-carbinolamine dehydratase; PHS; 4-alpha-hydroxy-tetrahydropterin dehydratase; Overlapping meiotic transcript 2; Pterin carbinolamine dehydratase; PCD; EC 4.2.1.96 (characterized)
to candidate SMc03834 SMc03834 pterin-4-alpha-carbinolamine dehydratase
Query= SwissProt::O42658 (96 letters) >FitnessBrowser__Smeli:SMc03834 Length = 104 Score = 95.5 bits (236), Expect = 1e-25 Identities = 43/77 (55%), Positives = 56/77 (72%) Query: 18 WILQQGDTKLFKSFRFKNFIEAWGFMSCVALRAQQLNHHPEWTNVYNKVDITLTTHDTKG 77 W+L + ++K+FRFK F EA+ FM+ A A++LNHHPEW NVYNKVD+TL+THD G Sbjct: 21 WVLAEDGGSIWKTFRFKTFAEAFTFMTQCAFAAEKLNHHPEWFNVYNKVDVTLSTHDADG 80 Query: 78 LTEKDLKLAEFIDTLAK 94 LTE D KLA +D A+ Sbjct: 81 LTELDFKLAAKMDQAAE 97 Lambda K H 0.319 0.131 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 45 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 96 Length of database: 104 Length adjustment: 11 Effective length of query: 85 Effective length of database: 93 Effective search space: 7905 Effective search space used: 7905 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.9 bits) S2: 39 (19.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory