Align Branched-chain amino acid ABC transporter permease LivH; SubName: Full=Branched-chain amino acid transporter permease subunit LivH; SubName: Full=L-leucine ABC transporter membrane protein /L-isoleucine ABC transporter membrane protein /L-valine ABC transporter membrane protein (characterized, see rationale)
to candidate SMc03118 SMc03118 ABC transporter permease
Query= uniprot:A0A0D9B2B6 (307 letters) >FitnessBrowser__Smeli:SMc03118 Length = 295 Score = 151 bits (381), Expect = 2e-41 Identities = 99/297 (33%), Positives = 164/297 (55%), Gaps = 17/297 (5%) Query: 7 FFQQLVNGLTVGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYVAFIAIAGLAMMGLD 66 F QL+ GL GS YAL+++G +++G++ +INFAHG YM+G+++A++ L+ +G+ Sbjct: 12 FLGQLLIGLINGSFYALLSLGLAIIFGLLRVINFAHGAQYMLGAFMAWLL---LSYLGIG 68 Query: 67 SVPLLMTAAFIASIVVTSSYGYSIERIAYRPLRGSNRLIPLISAIGMSIFLQNT--VLLS 124 P L+ A + ++ G IER R L + L L+ G+++ ++ T L Sbjct: 69 YWPALILAPLLVGLI-----GAVIERTMLRRLYTLDPLYGLLFTFGLALTIEGTFRYLYG 123 Query: 125 QDSKDKSIPNLIPGNFAIGPGGAHEVLISYMQIVVFVVTLVAMLGLTLFISRSRLGRACR 184 + + P L+ G +G + + + V V +LV LG L I +++LG R Sbjct: 124 ASGQPYATPALLMGGANLG-----FMFLPIYRGWVIVFSLVICLGTWLMIEKTKLGSYLR 178 Query: 185 ACAEDIKMANLLGINTNNIIALTFVIGAALAAIAAVLLSMQYGVINPNAGFLVGLKAFTA 244 A E+ + GIN ++ LT+ +GAALAAIA VL + Y V +P G + + F Sbjct: 179 AATENPVLVQSFGINVPFLLTLTYGLGAALAAIAGVLAAPIYQV-SPLMGSNIIIVVFAV 237 Query: 245 AVLGGIGSIPGAMLGGLVLGVAEAFGADIFGDQYKDVVAFGLLVLVLLFRPTGILGR 301 V+GG+GSI GA++ G +LG+AE +F + ++V F ++ +VLL RP G+ GR Sbjct: 238 VVVGGMGSIMGAIVTGYLLGIAEGL-TKVFYPEASNIVIFVIMAIVLLLRPAGLFGR 293 Lambda K H 0.327 0.144 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 289 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 295 Length adjustment: 27 Effective length of query: 280 Effective length of database: 268 Effective search space: 75040 Effective search space used: 75040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory