GapMind for catabolism of small carbon sources

 

Aligments for a candidate for paaJ1 in Sinorhizobium meliloti 1021

Align β-ketoadipyl-CoA thiolase (EC 2.3.1.174; EC 2.3.1.223) (characterized)
to candidate SMc00966 SMc00966 acetyl-COA acyltransferase

Query= metacyc::MONOMER-15952
         (401 letters)



>lcl|FitnessBrowser__Smeli:SMc00966 SMc00966 acetyl-COA
           acyltransferase
          Length = 397

 Score =  253 bits (645), Expect = 9e-72
 Identities = 171/400 (42%), Positives = 227/400 (56%), Gaps = 35/400 (8%)

Query: 5   LIIDAVRTPIGRYAGALASVRADDLGAIPLKALIARHPQLDWSAVDDVIYG-CANQAGED 63
           ++I A+RTP+GR  G+LA+V    L A+ ++ +IA    +D + +DDV+ G  AN AG  
Sbjct: 12  VVIAALRTPVGRVNGSLAAVEPARLAALLIERIIA-DTGIDRAEIDDVLVGNAANSAG-- 68

Query: 64  NRNVARMAALLAGLPVSVPGTTLNRLCGSGLDAVGSAARALRCGEAGLMLAGGVESMSRA 123
             N+AR+AAL AGLPV++PG T++R CGSGL+A+  AAR ++ G     LAGG ES SRA
Sbjct: 69  --NLARLAALEAGLPVAIPGVTVDRQCGSGLEAIVLAARQIQAGAGRFYLAGGTESASRA 126

Query: 124 ------PFVMGKSEQAFGRSAEIFDTTIGWRFVNKLMQQGFGIDSMPETAENVAAQFNIS 177
                 P   G+  Q   R+              ++     G   M   AENVA    IS
Sbjct: 127 HIRLRPPLTRGEEPQPVKRA--------------RMAPDSIGDPDMGVAAENVATACGIS 172

Query: 178 RADQDAFALRSQHKAAAAIANGRLAKEIVAVEIAQRKGPAKIVEHDEHPRGDTTLEQLAK 237
           R  QD FAL S  +A AA A GR ++EIV V   +  GP   +  DE PR + + E L++
Sbjct: 173 RERQDRFALESHRRAVAAEAEGRFSREIVPVPTPE--GP---IARDECPRANASAETLSR 227

Query: 238 LGTPFRQGGSVTAGNASGVNDGACALLLASSEAAQRHGLKARARVVGMATAGVEPRIMGI 297
           L   F  GG+VTAGNA  VNDGA  +L+ +   A++ G +        ATAGVEP+++G+
Sbjct: 228 LRPVFVAGGTVTAGNACPVNDGAAMVLMTNLAEARKLGTRFGLAFTDAATAGVEPKLLGL 287

Query: 298 GPVPATRKV-LELTGLALADMDVIELNEAFAAQGLAVLRELGLADDDERVNPNGGAIALG 356
           GPVPA  K+      L +A +D IE NEAFA+Q L  L +L +A   ERVN +GGAIALG
Sbjct: 288 GPVPAMAKLRARNPALDVARVDFIEFNEAFASQVLGSLDQLDIA--PERVNRDGGAIALG 345

Query: 357 HPLGMSGARLVTTALHE-LEERQGRYALCTMCIGVGQGIA 395
           HP G SGA LV     + L        L  M IG G GIA
Sbjct: 346 HPYGASGAILVVRLFSQMLAASSPAEGLAMMGIGGGMGIA 385


Lambda     K      H
   0.319    0.134    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 428
Number of extensions: 25
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 401
Length of database: 397
Length adjustment: 31
Effective length of query: 370
Effective length of database: 366
Effective search space:   135420
Effective search space used:   135420
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory